SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012341 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012341
Domain Number 1 Region: 390-625
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.02e-37
Family Calponin-homology domain, CH-domain 0.0000917
Further Details:      
 
Domain Number 2 Region: 87-241,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.48e-20
Family FAD/NAD-linked reductases, N-terminal and central domains 0.072
Further Details:      
 
Domain Number 3 Region: 782-815
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000105
Family LIM domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012341
Domain Number - Region: 816-844
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000767
Family LIM domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012341   Gene: ENSTTRG00000013001   Transcript: ENSTTRT00000013007
Sequence length 965
Comment pep:novel scaffold:turTru1:scaffold_98727:49105:107904:-1 gene:ENSTTRG00000013001 transcript:ENSTTRT00000013007 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEERKNEATNRAHILFDRFVQATTCKGTLKAFQELCDHLELKPKDHRSFYHKLKSKLNYW
RAKALWAKLDKRGSHKDYKKGKACTNTKCLIIGAGPCGLRTAIDLSLLGAKVVVIEKRDA
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGAIDHISIRQLQLILLKVALILGIEIHVN
VEFQGLVEPPEDQENERIGWRALVHPKTHPVSEYEFEVIIGGDGRRNTLEGFRRKEFRGK
LAIAITANFINRNTTAEAKVEEISGVAFIFNQKFFQELREATGIDLENIVYYKDDTHYFV
MTAKKQSLLDKGVILHDYADTELLLSRENVDQEALLSYAREAADFSTQQQLPSLDFAINH
YGQPDVAMFDFTCMYASENAALVREHGGHQLLVALVGDSLLEPFWPMGTGIARGFLAAMD
SAWMVRSWSLGRSPLEVLAERESIYRLLPQTTPENVSKNFSQYSIDPVTRYPNMNVNFLR
PSQVRHLYDTGETKDIHLEMENLVNSRTTPKLARNESVARSSKLLGWCQRQTDGYAGVNV
TDLTMSWKSGLALCAVIHRYRPDLIDFDSLDEQNVEKNNQLAFDIAEKELGISPIMTGRE
MASVGEPDKLSMVMYLTQFYEMFRDSLPSRDALLNAEERAVLVASTKSPISFLSXXXXXX
XXXXXXXXXXXXDLDGAGKRRTSQSEEEDAPRGYRGGRPTLVSTLSDRRVDVALGNQNKV
KYMATQLLAKFEENAPAQSTGVRRQPTQERGLSQPSCCLPEQGRPAPAPQWKQGSMKKEF
PQNLGGSDTCYFCRKRVYVMERLSAEGKFFHRSCFKCEYCATTLRLSAYAYALEDGKFYC
KPHYCYRLSGPVQRKRPAVAPLSGKEARGPLQDSPAADTNGQPSTSASPAERTPGPSVNG
LEEPSIAKRLRGTPERIELENYRLSVRQAEGLEEVPEETQAEHNLSSVLDTGTEEDAASR
SACGA
Download sequence
Identical sequences ENSTTRP00000012341 ENSTTRP00000012341

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]