SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012358 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012358
Domain Number 1 Region: 1281-1390
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 9.16e-33
Family Spermadhesin, CUB domain 0.00042
Further Details:      
 
Domain Number 2 Region: 241-350
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.44e-32
Family Spermadhesin, CUB domain 0.00054
Further Details:      
 
Domain Number 3 Region: 72-175
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 7.2e-32
Family Spermadhesin, CUB domain 0.00061
Further Details:      
 
Domain Number 4 Region: 1616-1735
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.62e-29
Family Spermadhesin, CUB domain 0.0014
Further Details:      
 
Domain Number 5 Region: 1450-1565
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.01e-28
Family Spermadhesin, CUB domain 0.001
Further Details:      
 
Domain Number 6 Region: 592-695
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-26
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Domain Number 7 Region: 414-522
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.57e-25
Family Spermadhesin, CUB domain 0.0011
Further Details:      
 
Domain Number 8 Region: 758-804,976-1037
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 2.42e-25
Family Spermadhesin, CUB domain 0.0018
Further Details:      
 
Domain Number 9 Region: 1098-1213
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 1.83e-21
Family Spermadhesin, CUB domain 0.0057
Further Details:      
 
Domain Number 10 Region: 2155-2223
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.67e-19
Family Complement control module/SCR domain 0.00094
Further Details:      
 
Domain Number 11 Region: 2511-2582
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.51e-19
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 12 Region: 2212-2281
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 1.16e-18
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 13 Region: 2395-2463
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.36e-18
Family Complement control module/SCR domain 0.00081
Further Details:      
 
Domain Number 14 Region: 2270-2343
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 2.92e-16
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 15 Region: 2452-2522
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 4.59e-16
Family Complement control module/SCR domain 0.0011
Further Details:      
 
Domain Number 16 Region: 1969-2036
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000122
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 17 Region: 2629-2686
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.00087
Further Details:      
 
Domain Number 18 Region: 2691-2759
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000403
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 19 Region: 2571-2640
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000445
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 20 Region: 2096-2157
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000167
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 21 Region: 11-72
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000025
Family Complement control module/SCR domain 0.00091
Further Details:      
 
Domain Number 22 Region: 1563-1632
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000792
Family Complement control module/SCR domain 0.0015
Further Details:      
 
Domain Number 23 Region: 356-416
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000836
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 24 Region: 2327-2389
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000987
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 25 Region: 1044-1108
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000167
Family Complement control module/SCR domain 0.0016
Further Details:      
 
Domain Number 26 Region: 697-767
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000181
Family Complement control module/SCR domain 0.0024
Further Details:      
 
Domain Number 27 Region: 1220-1283
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000121
Family Complement control module/SCR domain 0.0022
Further Details:      
 
Domain Number 28 Region: 1907-1974
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000175
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 29 Region: 1394-1452
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000634
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 30 Region: 1734-1794
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000229
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 31 Region: 2750-2807
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000445
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 32 Region: 2046-2101
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000514
Family Complement control module/SCR domain 0.0027
Further Details:      
 
Domain Number 33 Region: 1847-1904
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 0.0000000034
Family Spermadhesin, CUB domain 0.0052
Further Details:      
 
Domain Number 34 Region: 886-929
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000985
Family Complement control module/SCR domain 0.0036
Further Details:      
 
Domain Number 35 Region: 528-580
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000112
Family Complement control module/SCR domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012358   Gene: ENSTTRG00000013010   Transcript: ENSTTRT00000013024
Sequence length 3040
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3051:52290:382851:-1 gene:ENSTTRG00000013010 transcript:ENSTTRT00000013024 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PICQEIEKGGCGDPGIPAYGKRTGSSFLHGDSLTFECQAAFELVGERVITCQQNNQWSGN
KPSCVFSCFFNFTASSGIILSPNYPEEYGNNMNCVWLIISEPGSRIHLIFNDFDVEPQFD
FLAVKDDGISDITVLGTFSGNEVPSQLASSGHVVRLEFQSDHSTTGRGFNITYTXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
PCGGHLTASSGVILPPGWPGYYKDSLNCEWIIEAKPGHSIKITFDRFQTEVNYDTLEVRD
GPASSSPLIGEYHGTQAPQFLISTGNFMYLLFTTDNSRSSVGFLIRYESVTLESDSCLDP
GIPVNGHRHGSHFGIQSTVTFSCNPGYTLSDDEPLVCERNHQWSHALPSCDALCGGYIHG
KSGTVLSPGFPDFYPNSLNCTWTIEVSHGKGVQMIFHTFHLESSHDYLLITEDGSFSEPV
ARLTGSVLPHTIKAGLFGNFTAQLRFISDFSISYEGFNITFSYDLEPCDDPGVPAFSRRI
GFHFGVGDSLTFSCFPGYRLEATKLTCLGGVRRVWSASLPXXXXECGASVKGNEGTLLSP
NFPSNYDNNHECIYKIETEAGKGIHLRARSFQLFEGDILKVYDGRDSSSRPLGAFTKNEL
TGLILNSTSNHLWLEFNSNGSDTDQGFQLTYTSFDLVKCEDPGIPNYGYRIRDEGHFTDT
VVLYSCNPGYAMHGGNTLTCLSGDRRVWDRPLPSCVAECGGQIHAATSGRILSPGYPAPY
DNNLHCTWVVEADPGKTIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYGDSRERDTITFQCDP
GYQLQGQAKITCVQLNNRFFWQPDPTCIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXFNMEPSYDFLHIYEGEDSNSPLIGSFQGSQAPERIESSGNSLFLA
FRSDASVGLSGFAIEFKEKPREACFDPGNIMNGTRIGTDFKLGSTVTYQCDSGYKIADPS
SITCVIGADGKPAWNRVLPSCNAPCGGQYTGSEGVVLSPNYPHNYTAGQICLYSITVPKE
FVVFGQFAYFQTALNDLTELFDGTHPQARLLSSLSGSHSGETLPLATSNQILLRFSAKSG
APARGFHFVYQAVPRTSDTQCSSVPEPRYGRRIGLEFSAGSIVRFECNPGYLLQGSMAIR
CQSVPNALAQWNDTIPSCVVPCSGNFTQRRGTILSPGYPEPYGNNLNCIWKIIVTEGSGI
QIQVISFATEQNWDSLEIYDGGDVAAPRLGSFSGTTVPALLNSTSNQLYLHFQSDISVAA
AGFHLEYKTVGLAACQEPALPSNSIKTGDRYMVNDVLSFQCEPGYTLQGRSHISCMPGTV
RRWNYPSPLCIACEGTLSSMGGVISPGCGHYPSNLDCTWKIALPTGYGAHIQFLNFSTEA
NHDYLEIQNGPFHTSPMMGQFSGPDLPAPLLSTTHETLIHFYSDHSQNRQGFKLTYQAYG
LQNCPDPPPFQNGYMINSDYSVGQSVSFECYPGYILIGHRVLTCQHGINRNWNYPFPRCD
APCGYNVTSQNGTIYSPGFPDEYPILKDCVWLIMVPPGHGVYINFTLLQTEAVNDYIAVW
DGPDQNSPQLGVFSGNTALETAYSSTNQVLLKFHSDFSNGGFFVLNFHAFQLKKCQPPPA
VPQAEMLTEDEDFEIGDSVKYQCHPGYTLSGTDTLTCMLGSQLQFEGSLPTCEXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXEKQFDALEVFDGSSG
QSPLLVVLSGNHTEQSNFTSKSNQLYLRWSTDHATSKGFKIRYXXPYCSLTHTLKNGGVL
NRTTGEVGSKVHYFCKPGYRMIGHSNATCRRNPVGMYQWDSLAPLCQAVSCGIPESPGNG
SFTGNEFTLDSKVTYECNEGFKLDAGQQATAVCQEDGLWSNRGKPPTCKAVTCPGIEAQL
SEHVTWRLVSGSLNEYGAQVVLSCSPGYYLEGQRLVQCHANGTWSIGAERPRCRVISCGS
LSFPPNGNKIGTMTVYGATAIFTCNTGYTLVGSHVRECLANGLWSGPETRCLAGHCGSPD
PIVNGHISGDGFSYRDTVVYQCNPGFRLVGTSVRICLQDHKWSGHTPVCVPITCGHPGNP
AHGFTNGSEFNLNDVVNFTCNTGYLLQGASRAQCRSNGQWSSPLPTCRVVNCSDPGFVEN
AVRHEQQNFPESFEYGMSVVYHCKKGFYLLGSSALTCMANGLWDRSLPKCLVISCGHPGV
PANAILTGDLFTSGAVVHYSCQGRRSLVGNSSRTCQEDSHWSGALPHCTGNNPGFCGDPG
TPAHGSRLGDEFKAKSLLRFSCEMGYQLRGSAERTCLLNGSWSGLQPVCEAVSCGNPGTP
THGMIVSSDGVLFSSSVVYACWDGYRTSGLTTRHCTANGTWTGTAPDCTLISCGDPGTPA
NGLQFGTDFTFNSTVSYQCNPGYTMEPATSSTIRCTKDSAWDHSKPTCKAVMCGQPPPVQ
DGKVEGSDLRWGASVSYSCAQGFQLSHPAILSCEGRGVWKGEVPQCLPVFCGDPGTPAEG
RLSGKSFTYRSEVFFQCRSPFILVGSSRRICQADGTWSGTQPTCIDPAHNTCPDPGTPQF
GIQNSSRGYEVGSMVFFRCRKGYHVQGSTTRTCLANLTWSGIQTECIPHACRQPETPAHA
DVRAIDLPTFGYTLVYTCHPGFFLAGGSEHRTCKADMKWTGKSPVCKSKGVREVNETVTK
TPXXXXXXXXXXXXXXXYEYLGKRQPATLTVDWFNATSSKVNATFVEAAQGELKLAGVYK
KEEAHLLLKAFQIKGPVDIFVSNFENDNWGLDGYVSSGLERGGFTFQGDIHVKDFGKFKL
ERQGARSSAPDPARPQRGASSGSVAAAILAPLSALVLSGLAFHLHKHRARPKVQYNGYAG
HESSNGQASFENPMYDTNLKPTEAKAVRFDTTLNTVCTVV
Download sequence
Identical sequences ENSTTRP00000012358 ENSTTRP00000012358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]