SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012400 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012400
Domain Number 1 Region: 178-247
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000195
Family Complement control module/SCR domain 0.003
Further Details:      
 
Domain Number 2 Region: 238-298
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000334
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 3 Region: 42-158
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.021
Further Details:      
 
Domain Number 4 Region: 452-584
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000679
Family Fibronectin type III 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012400   Gene: ENSTTRG00000013066   Transcript: ENSTTRT00000013068
Sequence length 753
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_705:22816:150849:-1 gene:ENSTTRG00000013066 transcript:ENSTTRT00000013068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARGPRGAGFPPGRLLSLLPLLSLALGVPRAPGADALDVCATCHEHATCLQRGGKKMCIC
KYGFVGNGRTQCIDKNECQFGATVVCGNHTSCHNTLGGFYCICLEGYRATNNNKVFIPND
GTFCTDIDECEVSGRCRHGGRCVNTRGSFECYCMDGYLPKGGPEPFHPTRDATSCTEIDC
GTPPEVPDGYIIGNYTSRLGSQIRYACKEGFFSGPEDTVSSCTALGTWESPKLNCQEINC
GRPPEVQHAVLVGNHSSRLGGMAHYVCQEGFESPGGKITSVCTEKGIWRTSTLSCTEIII
EINDVSVFNNTCVRWQINPGRINSKIVYVIYIKGQRLDPMETVHEETVNLTTDNRTPKVC
LDLYQGTNYTMHISIASPRRSVPAIIEFQTAGDDLLEDDRIFNISVLNEACLKLNRHSRK
VGSERMYQXXXXXXXXXXXXXXXATSFNFTTREQTAVVCLDLYPATEYTVNVTLLGSPEQ
RSVQITMTTAPAVKQTISNISIFNETCLRWRSMKTADIEEMYLFHIWGQRWYQKEFAQEM
VFNITASSQAPETCLDLRPGTNYSVSIQALSSELPAVISLTTQITEPPLPEVDFFTVHGG
PLPRLRLRKAKEKNGPIXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVRRSSCAVWAQVKEMS
WNGFLMPGLRANGGTEIHRSRCSRWALGAPWLL
Download sequence
Identical sequences ENSTTRP00000012400 ENSTTRP00000012400

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]