SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012460 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012460
Domain Number 1 Region: 18-107
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000202
Family V set domains (antibody variable domain-like) 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012460   Gene: ENSTTRG00000013132   Transcript: ENSTTRT00000013130
Sequence length 218
Comment pep:known_by_projection scaffold:turTru1:scaffold_89058:39108:44550:-1 gene:ENSTTRG00000013132 transcript:ENSTTRT00000013130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQTASELPEEKCTLAEEQTLKVDGPITHDTDSNSRKAWQSLKDKGEVQTLAITERVSGEF
SQVQVGRYFLKDVPSESMLHVRMTNLRVEDTGLYQCVIYQPPKDPIILFYPVHLVTKNPS
GTPASGENPTQNFAQIPTLPPITTNYSKLHPSPRTVTQPLPTSATSVSSPGLEVTPTNVT
DVTRAPGTSTVIPVEHGLLSKSLVFIALFAVTQRSFAS
Download sequence
Identical sequences ENSTTRP00000012460 ENSTTRP00000012460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]