SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012542 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012542
Domain Number 1 Region: 67-318
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.03e-55
Family Voltage-gated potassium channels 0.00083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012542   Gene: ENSTTRG00000013226   Transcript: ENSTTRT00000013220
Sequence length 480
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2465:94182:284009:-1 gene:ENSTTRG00000013226 transcript:ENSTTRT00000013220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HRDAEEALDIFETPALIGGDPGDDEDLAAKRLGIEDAAGLGGPDGKSGRWRRLQPRMWAL
FEDPYSSRAARFIAFASLFFILVSITTFCLETHEAFNIVKNKTEPVINGTSVVLQYEIET
DPALTYVEGVCVVWFTFEFLVRIVFSPNKLEFIKNLLNIIDFVAILPFYLEVGLSGLSSK
AAKDVLGFLRVVRFVRILRIFKLTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFAT
MIYYAERVGAQPNDPSASEHTQFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALCA
LAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPRKRKKHIPPAPQATSPTFCKTELNMACN
STQGDTCLGKDNRLPEHNRSVLSGDDSTGSEPPLSPPERLPIRRSSTRDKHRRGETCFLL
TTGDYTCASDGGIRKGYEKSRSLNNIAGLAGNALRLSPVTSPYNSPCPLRRSRSPIPSIL
Download sequence
Identical sequences ENSTTRP00000012542 ENSTTRP00000012542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]