SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012547 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012547
Domain Number 1 Region: 7-118
Classification Level Classification E-value
Superfamily PH domain-like 2.09e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.00000439
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012547   Gene: ENSTTRG00000013217   Transcript: ENSTTRT00000013223
Sequence length 436
Comment pep:known_by_projection scaffold:turTru1:scaffold_111159:205453:321015:1 gene:ENSTTRG00000013217 transcript:ENSTTRT00000013223 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSCVTVFKVPHQEENGCADFFIRGERLRD
KMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAIEDISQGC
PAFKNETEGAEDNLQAAEEDTSSSLVKDHLFQQETVITSEPYRSSRPSPFEDLNARRVYL
QSQANQIMFSHPGLDIQGRSIEYVQRQIPKECGSLKSQNKVPLKSIRHVSFQDEDEIVRI
NPRDILIRRYADYRHPDMWKSDLERDDTDSSIQFSKPDSKKSDYLYSCGDETKLSSLKDS
VVFKTQPSSLKFKKSKRRKEDGERSRCVYCQERFNHEENGRGKCQDAPDPIKRCIYQVSC
MLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCYVPLRMCHR
CGEACGCCGGKHKAAG
Download sequence
Identical sequences ENSTTRP00000012547 ENSTTRP00000012547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]