SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012559 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012559
Domain Number 1 Region: 95-312
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.83e-69
Family (Glycosyl)asparaginase 0.000000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012559   Gene: ENSTTRG00000013240   Transcript: ENSTTRT00000013238
Sequence length 313
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_762:438488:447483:-1 gene:ENSTTRG00000013240 transcript:ENSTTRT00000013238 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARKPNPAVLLSLLLLCQAPVCSSGPLPLILNTWPFRNAAVAXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTTMNVGAVGDLRRIKNAIGVARKVLE
HTTHTLLAGESATKFAESMGFINEDLSTNASCALHSDWLAWNCQPNYWRNVIPDASKYCG
PYKPPSILKRDGSTYKETGDSYGHDTIGMVVIHKMGNIAAGTSTNGIKFKIPGRIGDSPI
PGSGAYADDTAGAAAATGDGDILMRFLPSYQAVEYMRRGEDPTTACRKVISRIQKYFPNF
FGAVVCANVTGSY
Download sequence
Identical sequences ENSTTRP00000012559 ENSTTRP00000012559

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]