SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012656 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012656
Domain Number 1 Region: 216-452
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.68e-57
Family DBL homology domain (DH-domain) 0.0000387
Further Details:      
 
Domain Number 2 Region: 474-571
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000000958
Family Pleckstrin-homology domain (PH domain) 0.0071
Further Details:      
 
Domain Number 3 Region: 32-92
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000331
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012656   Gene: ENSTTRG00000013341   Transcript: ENSTTRT00000013341
Sequence length 987
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2208:433751:451620:-1 gene:ENSTTRG00000013341 transcript:ENSTTRT00000013341 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCCCCGCCPLLAHLERGSLGERTREKEKMKEAKDARYTNGHLFTTISVSGMTMCYACNKS
ITAKEALICPTCNVTIHNRCKDTLANCTKVKQKQQKAALLKNNTALQSVSLRSKTTTRER
PSSAIYPSDSFRQSLLGSRRGRSSLSLAKSVSTTNIAGHFNDESPLGLRRILSQSTDSLN
MRNRTLSVESLIDEAEVIYNELMSDFEMDEKDFAADSWSLAVDSNFLQQHKKEVMKQQDV
IYELIQTELHHVRTLKIMTRLFRTGMLEELQLEPGVVQGLFPCVDELSDIHTRFLSQLLE
RRRQALCPGSPRNFVIHRLGDLLINQFSGPSAEQMRKTYSEFCSRHTKALKLYKELYARD
KRFQQFIRKVTRSAVLKRHGVQECILLVTQRITKYPVLINRILQHSHGIEEERQDLTTAL
GLVKELLSNVDQDVHELEKGARLQEIYNRMDPRAQAPVPGKGPFGREELLRRKLIHDGCL
LWKTATGRFKXXXXXXXXXXXXXXXXXXXXXXXXXXDKPSVVSLQNLIVRDIANQEKGMF
LISAAPPEMYEVHTASRDDRSTWIRVIQQSVRVCPSREDFPLIETEDEAYLRRIKMELQQ
KDRALVELLQEKVGLFAEMTHFQVEEDGGSGMPLPTLPRGLFRSESLESPRGERLLQDAI
REVEGLKDLLVGPGVELLLTPREPTLSMEPDSGGNTSPGVTANGEARTFNGSIELCRADS
DSSQKDRNGNQLRSPQEEALQRLVNLYGLLHGLQAAVAQQDTLMEARFPEGPERREKLTR
ANSRDGEAGRAGAAPVAPEKQATELALLQRQHTLLQEELRRCRRLGEERATEAGSLEARL
RESEQARALLEREAEEARRQLAALGHTEPLPAEAPWARRPLDPRRRSLPAGDALYLSFTP
PQPSRGHDRLDLPVTIRSVHRPFEDRERQELGSPDERLQDSSDPDTGSEEEGSSRLSPPH
SPRDFTRMQDIPEETESRDGEPVASES
Download sequence
Identical sequences ENSTTRP00000012656 ENSTTRP00000012656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]