SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012747 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012747
Domain Number 1 Region: 1169-1391
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.01e-62
Family DBL homology domain (DH-domain) 0.0000000237
Further Details:      
 
Domain Number 2 Region: 1391-1532
Classification Level Classification E-value
Superfamily PH domain-like 1.98e-30
Family Pleckstrin-homology domain (PH domain) 0.00000161
Further Details:      
 
Domain Number 3 Region: 1546-1666
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.36e-27
Family PLC-like (P variant) 0.0043
Further Details:      
 
Domain Number 4 Region: 4-97
Classification Level Classification E-value
Superfamily EF-hand 1.78e-25
Family Eps15 homology domain (EH domain) 0.00063
Further Details:      
 
Domain Number 5 Region: 740-822
Classification Level Classification E-value
Superfamily SH3-domain 8.53e-20
Family SH3-domain 0.0000363
Further Details:      
 
Domain Number 6 Region: 960-1021
Classification Level Classification E-value
Superfamily SH3-domain 1.84e-19
Family SH3-domain 0.0000331
Further Details:      
 
Domain Number 7 Region: 1027-1103
Classification Level Classification E-value
Superfamily SH3-domain 4.46e-16
Family SH3-domain 0.0000201
Further Details:      
 
Domain Number 8 Region: 887-938
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000021
Family SH3-domain 0.000037
Further Details:      
 
Domain Number 9 Region: 1133-1170
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000853
Family SH3-domain 0.00028
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012747
Domain Number - Region: 221-256
Classification Level Classification E-value
Superfamily EF-hand 0.0572
Family Eps15 homology domain (EH domain) 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012747   Gene: ENSTTRG00000013435   Transcript: ENSTTRT00000013435
Sequence length 1676
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2798:190330:575470:-1 gene:ENSTTRG00000013435 transcript:ENSTTRT00000013435 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GGPNMWAITSEERTKHDKQFDNLKPSGGYITGDQARTFFLQSGLPAPVLAEIWALSDLNK
DGKMDQQEFSIAMKLIKLKLQGQQLPVVLPPIMKQPPMFSPLISARFGMGSMPNLSLPQS
LPPVAHIATPLSSATSGTTRPPLMMPAPLVPSVSTSSLPNGTASLIQPLSIPYSSSTLPH
TSSYSLMMGGFGGASIQKAQSLIDLGSSSSTSSTASLSGNSPKTGTSEWAVPQPSRLKYR
QKFNSLDKSMSGYLSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTFEDKRKA
NYERGNMELEKRRQAMMEQQQREAERKAQKEKEEWERKQRELQEQEWKKQLELEKRLEKQ
RELERQREEERRKEIERREAAKQELERQRRLEWERIRRQELLNRRNREQEEIVRLNSKKK
SLHLELEALNGKHQQISSRLQDVRLRKQTQKTELEVLDKQCDLEIMEIRQLQQELQEYQN
KLIYLVPEKQLLNERIKNMQLSNTPDLGVGLLHKKSLEKEELCQRLKEQLDALEKETASK
LSEMDSFNNQLKCGNMDDSVLQCLLSLLSCLNNLFLLLKELRESYNTQQLALEQLYKIKR
DKLREIERKRLELIQKKKLEDEATRKAKQGKENLWKENLRKEEEEKQKRLQEEKTQEKVQ
EVEWKAEEKQSKDKDKISEPAGALVNYRALYCFEARNHDEMSFNSGDIIQVDEKTIGEPG
WLYGSFQGNFGWFPCNYVEKITSEKSVSPKKALLPPTVSLSATSTSESLSSNQPASVTDY
QNVSFSSLTVNTSWQKKSAFTRTVSPVSTSPIHGQGQVVENKAQTCSWTAKKDNHLNFSK
HDIITVLEQQENWWFGEVHGGRGWFPKSYVKIIPGSEVRREEPEALYAAVNKKPTSAAST
VGEEYIALYPYSSAEPGDLTFTEGEEILVTQKDGEWWTGSIGDRTGIFPSNYVKPKDHED
FASASKSGTSNKKPEIAQVTSAYVASGSEQLSLAPGQLILILKKNTSGWWQGELQARGKK
RQKGWFPASHVKLLGPSSERTTPAFHPXXXXXXXXXXXXXXXXXXXXXXXXLINVLNKDD
PDWWQGEINGVTGLFPSNYVKMTTDTDPSQQWCADLQTLDTMQPVERKRQGYIHELMETE
ERYVDDLQLVVEVFQKRMAEPGFLTEGETALIFVNWKELIMSNTKLLKALRVRKKTGGEK
MPVQMIGDILAAELSHMQAYIRFCSCQLNGAALLQQKTDEHADFKEFLKRLASDPRCKGM
PLSSFLLKPMQRITRYPLLIRSILENTPENHVDHSSLKLALERAEELCSQVNEGVREKEN
SDRLEWIQTHVQCEGLAEQLVFNSLTNCLGPRKLLHSGKLYKTKSNKELHGFLFNDFLLL
TYMVKQFAVSSGSEKLFSSKSNAQFKMYKMPIFLNEALVKLPTDPSSDEPVFHISHIDRV
YTLRTDNINERTAWVQKIKAASEQYIDTEKKKREKAYQARSQKSSGIGRLMVHVIEATEL
KACKPNGKSNPYCEISMGSQSYTTRTLQDTLNPKWNFNCQFFIKDLYQDVLCLTMFDRDQ
FSPDDFLGRTEVPVAKIRTEQESKGPTTRRLLLHEVPTGEVWVRFDLQLFEQKTLL
Download sequence
Identical sequences ENSTTRP00000012747 ENSTTRP00000012747

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]