SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012815 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012815
Domain Number 1 Region: 951-1056,1102-1144
Classification Level Classification E-value
Superfamily Ras GEF 1.96e-36
Family Ras GEF 0.0021
Further Details:      
 
Domain Number 2 Region: 400-598
Classification Level Classification E-value
Superfamily Ras GEF 3.01e-28
Family Ras GEF 0.0023
Further Details:      
 
Domain Number 3 Region: 267-381
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.8e-16
Family cAMP-binding domain 0.0013
Further Details:      
 
Domain Number 4 Region: 17-118
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000000000982
Family cAMP-binding domain 0.0065
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012815
Domain Number - Region: 748-808
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00121
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012815   Gene: ENSTTRG00000013495   Transcript: ENSTTRT00000013507
Sequence length 1602
Comment pep:novel genescaffold:turTru1:GeneScaffold_2163:4035:206922:-1 gene:ENSTTRG00000013495 transcript:ENSTTRT00000013507 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNSPVDPGARQALKKKPPERTPEDLNTIYSYLHGMEILSNLREHQLRLMSARARYERYSG
NQVLFCSETIARCWYILLSGSVLMKDSMVLPPCSFGKQFGGKRGCDCLVLEPSEMIVVEN
SKDNEDSILQREIPARQSRRRFRKINCKGERQTITDDVDINSYLSLPADLTKMHIADNPH
PQVTHVSSSQSGCSIASDSGSSSLSDIYQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXEQLLEFMHQLPAFANMTMSVRRELCSVMIFEV
VEQAGAIILEDGQELDSWYVILNGTVEISHPDGKVENLFMGNSFGITPTLDKQYTHGVVR
TKVDDCQFVCIAQQDYWRILIHVEKNTVLKEIVMVHEHRELDRSGTRKGHIVIKATPERL
IMHLIEEHSIVDPTYIEDFLLTYRTFLESPLDVGTKLLEWFKIDSLRDKVTRIVLLWVNN
HFNDFEGDPAMTRFLEEFEKNLEDTKMNGHLRLLNIACAAKAKWRQVVLQKASRESPLHF
SLNGGSEKAFGIFVEGVEPGSKAADAGLKRGDQIMEVNGQNFENITFVKALEILRNNTHL
ALTVKTNIFVFKELLTRTEQEKSGVPHIPKIAEKKSNRHSIQDVPGDIEQTSQEKGNKKI
KANTVSGGRNKIRKILDKTRFSILPPKLFSDVGLSQSQDDSIVGTRHCRHSLAIMPIPGT
LSSSSPDLLQPTTSMLDFSNPSDIPDQVIRVFKADQQSCYIIICKDTTAKEVVCQAIHEF
GLTGASDTYSLCEVSVTPEGVIKQRRLPDQFSKLADRIQLNGXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGLNLASVAR
LRGTWEKLPSKYEKHLQDLQDLFDPSRNMAKYRNILSSQSMQPPIIPLFPVVKKDMTFLH
EGNDSKVDGLVNFEKLRMIAKEIRQVVRMTSANMDPAMMFRQRSLSQGSTNSNMLDVQGG
AHKKKARRSSLLNAKKLYEDAQMARKVKQYLSSLDVETDEEKFQMMSLQWEPAYGTLTKN
LSEKRSVKSSEMSPVPVRSAGQAAKAYLHQPHRVSQVLQVPAVNLHPIRKKGQAKDPATL
STSLPQKILGTTEEISGKKHTEDTISVASSLHSSPPASPQGSPRKGYTLIPSAKSDNLSD
SSHSEISSRSSIVSNCSVDSMSAALQDERCSSQAVAVPESTGAFEKTEHSSGIGDHSQPG
PGWTLSKPSLIKNLAVSSSVSNDEISHEHIIIEAADSGRGSWTSCSSSSHDNFQSLPNPK
GWDFLNSYRHTHLDGPIAEVEPTDCEPCTCPKGCSRTCGQCKGSLETNQLRQSWASSSSL
SDTYEPNYGTVKRRVLESTPAESSEGLDHKDGIDPVYKTVTSSTEKGLIVYCVTSPKKED
RYREPPPTPPGYMGISLADLKEGPHLHLKPPDYSVAVQRSKMMHNSLSRLPPASLSSNPV
ACVPSKIVTQPQRHNLQPSHPKLADVTDADSEADENEQVSAV
Download sequence
Identical sequences ENSTTRP00000012815 ENSTTRP00000012815

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]