SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012832 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012832
Domain Number 1 Region: 6-135
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.46e-47
Family Proteasome subunits 0.000000235
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012832
Domain Number - Region: 183-251
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.000523
Family Proteasome subunits 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012832   Gene: ENSTTRG00000013526   Transcript: ENSTTRT00000013524
Sequence length 255
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2405:464509:487486:1 gene:ENSTTRG00000013526 transcript:ENSTTRT00000013524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIGTGYDLSASTFSPDGRVFQVEYAMKAVENSSTAIGIRCKDGVVFGVEKLVLSKLYE
EGSNKRLFNVDRHVGMAVAGLLADARSLADIAREEASNFRSNFGYNIPLKHLADRVAMYV
HAYTLYSAVRPFGCXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XMKEMTCCDVVKEVAKIIYIVHDEVKDKAFELELSWVGEITNGRHEIVPKDIREEAEKYA
KESLKEEDESDDDNM
Download sequence
Identical sequences ENSTTRP00000012832 ENSTTRP00000012832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]