SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012921 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012921
Domain Number 1 Region: 663-772
Classification Level Classification E-value
Superfamily PH domain-like 2.19e-17
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 2 Region: 78-139
Classification Level Classification E-value
Superfamily F-box domain 0.000000000159
Family F-box domain 0.0024
Further Details:      
 
Domain Number 3 Region: 497-547
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 0.00000000772
Family DBL homology domain (DH-domain) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012921   Gene: ENSTTRG00000013616   Transcript: ENSTTRT00000013617
Sequence length 774
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3432:5977:68100:1 gene:ENSTTRG00000013616 transcript:ENSTTRT00000013617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESFHTRFSAWTPFSNKSLNQLFQERVALISHFDLWTNKQHQEFLFTIFLCTKLQLRVVQ
DCFSERMQVAKVDFSRFISLCIFSFPKDLCAAAQVSWPWKFLTEQDCLWMSKCMKFGWFL
PYTPTDNEYGAWKHHYIAVSNLDLTPREAAALYGTLNEPKTEDEQLQERQREKCLRKIIW
EKIALRKKNLFKVRPPWVNGTCCSRLFESKCQPRLSQTVRDRVGLQDTLEKQLVFASLEA
LPKRSNVFGCHSYPLLSKKNWHGVYKNDSSSSHALQPHFILISSRIPAYEMVVNSVRADX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXAGTEVLSQLSQLTGTLLT
APTGIATVSYQHILSDWLGRQWEKAPPSTYFSKSKLQTWSSLTDFLEDTLKSVRQQLSPL
FKELQKNVSGRMTGQFVSDTMSMANILNNREIIQALAEGLIEISKENSERNVIEDNPRDT
KSSLSKNGPNFELLFELWFLDDLRDRLQEWGPAHCVGEIFIKFGSQLNIYTNFFHNYPVI
LKTMEKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXKGYIDQMKQNINMKDQLSNIERIICGCLTLSEVNRYLIRVQDV
AQLHCCDEELSFSLRLYEHTCDLSLFLFNDALLVSSGGTSHTPFERTSKSTYQFIASVAL
HRLLIEDIPDSKYIKNAFILQGPKHEWICATEVEDDKFLWLSVLQNAIESSMEK
Download sequence
Identical sequences ENSTTRP00000012921 ENSTTRP00000012921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]