SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012935 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012935
Domain Number 1 Region: 324-441
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.01e-36
Family Regulator of G-protein signaling, RGS 0.0000405
Further Details:      
 
Domain Number 2 Region: 20-124
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.74e-27
Family DEP domain 0.019
Further Details:      
 
Domain Number 3 Region: 249-313
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 2.88e-19
Family Transducin (heterotrimeric G protein), gamma chain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012935   Gene: ENSTTRG00000013634   Transcript: ENSTTRT00000013633
Sequence length 565
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3034:45348:387990:1 gene:ENSTTRG00000013634 transcript:ENSTTRT00000013633 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGSGDQRTVGIADPEESSPNMIVYRKIEDIITKMQDDKTGGVPIRTVKSFLSKIPSVV
TGTDIVQWLMKNLSIEDPVEAIHLGSLVAAQGYVFPISDHVLTMKDDGTFYRFQAPYFWP
SNCWEPENTDYAIYLCKRTMQNKARLELADYEAENLARLQRAFARKWEFIFMQAEAQVKI
DRKKDKTERKILDSQERAFWDVHRPVPGCVNTTEMDIRKCRRLKNPQKVKKSVYGVTEES
QSQSPVHVPSQPIRKTTKEDIRKQITFLNAQIDRHRLKMSKVAESLIAYTEQYVEYDPLV
TPAEPSNPWISDDIALWDIEMSKEPSQHRVKRWGFSFDEILKDQVGRDQFLRFLESEFSS
ENLRFWLAVQDLKKQPLQDVAKRVEEIWQEFLAPGAPSAINLDSHSYEITSQNVKDGGRY
TFEDAQEHIYKLMKSDSYARFPVKCLPGLAARQEEXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
QVEAHVYNPLVHVSCADTPLSRGSW
Download sequence
Identical sequences ENSTTRP00000012935 ENSTTRP00000012935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]