SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000012977 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000012977
Domain Number 1 Region: 621-821
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.1e-37
Family DBL homology domain (DH-domain) 0.000005
Further Details:      
 
Domain Number 2 Region: 318-424
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000264
Family Spectrin repeat 0.0066
Further Details:      
 
Domain Number 3 Region: 905-960
Classification Level Classification E-value
Superfamily PH domain-like 0.000000924
Family Pleckstrin-homology domain (PH domain) 0.017
Further Details:      
 
Domain Number 4 Region: 41-192
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000107
Family CRAL/TRIO domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000012977
Domain Number - Region: 430-523
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0456
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000012977   Gene: ENSTTRG00000013658   Transcript: ENSTTRT00000013677
Sequence length 1114
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_148:1216:213582:-1 gene:ENSTTRG00000013658 transcript:ENSTTRT00000013677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLFWLKEEMAPQEFTRRLTTVIARVDEIMQQEIRPLVAVDIIEQLHRQFAILSGGRGKDG
APIITFPEFVGFKHIPDEDFLNVMTYLTSVPSVEAASIGFVIVIDRRRDKWSSVKASLTR
IAVAFPGNLQLIFILRPSCFIQRTFTDIGIKYYRDEFKMKVPIVMLNSISDLHHYIDKSQ
LTEDLGGTLEYHHSQWINHRTAIENFALALKSTAQMLQTFGACLAATELPRSMSSSEDLL
MSHTRQQGKLQDELKLLGKQGTTLLSCIQGQATKSPTSKLSLNEAENVATMERLLVQLNE
TERAFSQFWSAHHLKLNQCLQLRHFEHNFCEVKLALDNVLAEQAEFTDIGDSAMRVEQLL
KEYKKLEGKGQESLEKAQLLAVIGDQLIQSHHYAVDSIRPQCAELRHLCDDFINENKKKH
DILEKSLELHRQLDKVSQWCEEGIYLLASQAVDKCQSREGVDIALTDIETFLGTAKEYQL
PSPNEFYNQYELMLTLDVKAKAQKVLQKLGDVQEIFHKRQMSLMKLAARQTRPVQPVAPR
PEFSPKWVSPKIRQPSTLVSLAPHQKTSEECYVETDLNSVEKEDDETKFEVKXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXRIIRDLLETEETYIKEIKNIIDGYIIPMDFIWLKHLIPD
VLRNNKEFLFGNIRELYEFHNRTFLKELEKCTENPELLARCFLKRKEDLQIYFKYHKNLP
RARAIWQECQDCTYFGVCQRQLGHSLPLFKYLRGPSQRLTKYQMLLKGLLDFESPEDLEM
DPGDLEGGLAKNGPEKTKDSAFSDDLQQALAMMEDLIKSCELAVDLAAVTGCPDDIRKLG
KLLMHGSFNVWTHKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXLMTLSIRQLGRGSNRKFEIANQNGLEKYILQAASKETRDCWFSEISKLLLEQQNNI
KXXXXXXXXXXXXKGNEVEFAPWIENMERATSNKEVSVPSTCQIKXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSVQETGESIQGEKEGGEEDTATNKTEES
PGMSAGLLTPVGTGFRAEAVRAREGGLRPPSAEN
Download sequence
Identical sequences ENSTTRP00000012977 ENSTTRP00000012977

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]