SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013018 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013018
Domain Number 1 Region: 431-665
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 7.85e-33
Family Voltage-gated potassium channels 0.02
Further Details:      
 
Domain Number 2 Region: 1117-1205,1232-1384
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.67e-32
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 3 Region: 51-221,271-341
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.8e-26
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 798-854,888-953,993-1071
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.31e-22
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013018
Domain Number - Region: 1389-1539
Classification Level Classification E-value
Superfamily EF-hand 0.00106
Family Calmodulin-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013018   Gene: ENSTTRG00000013716   Transcript: ENSTTRT00000013724
Sequence length 1856
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2294:85809:147346:-1 gene:ENSTTRG00000013716 transcript:ENSTTRT00000013724 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPSSPQDEGLRKKQPKKPVPEVLPRPPRALFCLTLQNPVRRACISIVEWKPFETIILLT
IFANCVALAAYLPMPEDDSSALNLGLEKXXXXXXXXXXXEATMKIIAYGFLFHPDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQTNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSVFKAMQPLFHIALLVLFMAIIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRRCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLD
EDLRGYLSWITQGEVMDVDDLREGKLALDEGGSDTESLYEIAGLNKVIQFIRQWRRWNRV
FRWKCHDAVKSRVFYWLVILIVALNTLSIASEHHHQPLWLTHLQDIANRVLLALFTVEML
MKMYGLGLRQYFMSIFNRFDCFVVCSGLLEILLVESGAMTPLGISVLRCIRLLRIFKITK
YWTSLSNLVASLLNSIHCIASLLLLLSLFVVIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALITVFQVLTAEDWNSVMYDGIMAYGGPTYPGVLVCIYFIILFVCGNXILLNVFLAIA
VDNLAEAESLTSAQKAKAEERRRRKMSRGLPDKSEEEKSMVAKKLEQKPKGEGIPTTAKL
KVDEFESNVNEVKDPYPSADFPGDDEEDEPEIPISPRPRPLAELQLKEKAVPIPEASAFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRTESVRNQILGYFDIVFT
SVFTVEIVLKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDL
SKMTEEECRGYYYVYKDGDPTQVELRPRQWTHSNFHFDNVLSAMMSLFTVSTFEGWPELL
YRAIDSHEEDKGPVYNERPEMAVFFIVYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LNKNQRQCVQYALKARPLKCYIPKNPCQYQVWYIVTSSYFEYLMFALIMLNTICLGMQHY
NQSEQMDHISDILNVAFTTIFTVEMVLKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGSCGNVDPDESARISSAFFRLFRVLRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMLGKIALVDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEILLACSYGQLCDPESDYAPGEERTCGTDFAYYYFISFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMRRQEEYYGYRPKKDTVQIQAGLR
TLEEEAAPEIRRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGRVDSFLERTNSLPP
HMANQRPLQFTEIEMQELESPVFLEDFPQHPSTNPLARANTNNANANVAGGNSNHGNSPA
FFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPHSKSHGERLQGQLPRRAIRGARAPANP
CQLGDTSLVPEEAPPKDGTPGCPAPAMALLIREALVRGGLDTLAADAKFVMATGHTLVEA
CQMELQEVEVAAAELLKGRETLEGVASARGRWSLGSSLGSLDQHQGSQETLIPRRL
Download sequence
Identical sequences ENSTTRP00000013018 ENSTTRP00000013018

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]