SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013079 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013079
Domain Number 1 Region: 622-686,893-1194
Classification Level Classification E-value
Superfamily Ras GEF 2.22e-84
Family Ras GEF 0.00011
Further Details:      
 
Domain Number 2 Region: 221-444
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.14e-43
Family DBL homology domain (DH-domain) 0.00025
Further Details:      
 
Domain Number 3 Region: 432-587
Classification Level Classification E-value
Superfamily PH domain-like 0.00000000000129
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013079
Domain Number - Region: 93-154
Classification Level Classification E-value
Superfamily PH domain-like 0.00289
Family Pleckstrin-homology domain (PH domain) 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013079   Gene: ENSTTRG00000013785   Transcript: ENSTTRT00000013788
Sequence length 1197
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_856:1499:230941:1 gene:ENSTTRG00000013785 transcript:ENSTTRT00000013788 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQKSVRYGHALYLVFLRKEGTKRXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYYFTVLFGHEGQKPLELRCEEEQDGKE
WMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIAANQLRHQLEDQDTEIERLKSEII
ALNKTKERMRPYQSNQEDEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAESMRK
RNQIVFTMVEAESEYVHQLYILVNGFLRPLRMAASSKKPPISHDDVSSIFLNSETIMFLH
EIFHQGLKARIANWPTLILADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFDKLL
KQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLEELS
RVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKVRLG
SLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIECTLVEEPDTSDDDSKGS
GQVFGHLDFKIVVEPPDAAPFTVVLLAPSRQEKAAWTSDISQCVDNIRCNGLMTIVFEEN
SKVSVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSIDFLN
TFLHTYRIFTTAAVVLGKLSDIYKRPFTSIPVRSLELFFATSQNSRGEHLVDGKSPRLCR
KFSSPPPLAVSRTSSPVRARKLSLTSPLNSRIGALDLTTCSASSSPTTTHSPAASPPPHT
GKVPLDLSRGLSSPEQSPGSVEEHVVNPRVDLCNKLKRSIQRAVLESAPVDRAGVESSPA
ADATEPSPCRSPSTPRHLRYRQPGGQTADNSHCSVSPASAFAIATAAAGHGSPSGFNNTE
RTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLEEVLRDPDLLPQER
KATANILRALSQDDQDDIHLKLEDIIQLTDCPKAECFETLSAMELAEQITLLDHIVFRSI
PYXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMSNLVASQIMNYADISSRANAIEKWVAVA
DICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQKTISSEGRFKNLRE
TLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMKGRVRESCQFQQTS
Download sequence
Identical sequences ENSTTRP00000013079 ENSTTRP00000013079

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]