SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013087 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013087
Domain Number 1 Region: 1567-1809
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.18e-52
Family Ankyrin repeat 0.00000137
Further Details:      
 
Domain Number 2 Region: 476-591
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000008
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 3 Region: 349-477
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Domain Number 4 Region: 965-1007
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000306
Family EGF-type module 0.015
Further Details:      
 
Domain Number 5 Region: 274-316
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000553
Family EGF-type module 0.0098
Further Details:      
 
Domain Number 6 Region: 1241-1272
Classification Level Classification E-value
Superfamily Notch domain 0.00000017
Family Notch domain 0.0024
Further Details:      
 
Domain Number 7 Region: 583-618
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000343
Family EGF-type module 0.012
Further Details:      
 
Domain Number 8 Region: 1003-1045
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000782
Family EGF-type module 0.01
Further Details:      
 
Domain Number 9 Region: 1039-1083
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000954
Family EGF-type module 0.015
Further Details:      
 
Domain Number 10 Region: 311-357
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000254
Family EGF-type module 0.01
Further Details:      
 
Domain Number 11 Region: 30-62
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000288
Family EGF-type module 0.024
Further Details:      
 
Domain Number 12 Region: 64-116
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000343
Family EGF-type module 0.02
Further Details:      
 
Domain Number 13 Region: 234-277
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000495
Family EGF-type module 0.042
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013087
Domain Number - Region: 1131-1172
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000295
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 1212-1234
Classification Level Classification E-value
Superfamily Notch domain 0.00889
Family Notch domain 0.0065
Further Details:      
 
Domain Number - Region: 211-230
Classification Level Classification E-value
Superfamily EGF/Laminin 0.02
Family EGF-type module 0.027
Further Details:      
 
Domain Number - Region: 1085-1123
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0219
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013087   Gene: ENSTTRG00000013793   Transcript: ENSTTRT00000013797
Sequence length 1982
Comment pep:novel genescaffold:turTru1:GeneScaffold_3467:18630:36957:-1 gene:ENSTTRG00000013793 transcript:ENSTTRT00000013797 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPPSLLLPLLLLLCRSVVQTRGLQCGSFPEPCANGGTCLSLSQGQGTCQCAPGFLGETC
QFPDPCQGAQLCRNGGSCQALLPTLPSPPSPPSPSAPSFFCACPSGFTGERCQAQLKDPC
SSFCSKMGRCHVQASGRPQCSCMPGWTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLGSFQCLCPAGWGGPRCELRPGPCPPRGC
PSGGTCQVVPGRDSTFHLCLCLPGFTDPSCEVNPDDCVGHQCQNGGTCQDGLGTYTCLCP
EAWAGWDCSEDVDECEAQGPPRCRNGGTCQNSAGGFHCVCVSGWGGTGCEENLDDCVAAT
CAPGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLSQPCHREAQCNTNPLRGSTFCVCQPG
YTGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFDCLCPPGYTGSRCEADHNECLSQP
CHPGSTCLDLLATFQCLCPPGLEGRLCEVETDECASAPCLNQADCHDLLNGFRCVCRPGF
TGPRCEEDIDECRSSPCANGGQCQDQPGSFHCKCLPGFEGPRCQAEVDECLSGPCPTGAS
CLDLPGAFLCLCPSGFTXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCTPGYSGQ
NCSKEPDACQSQPCHNHGTCTPKPGGFHCACPPGFVGLRCEGDVDECLDQPCNPTGTAAC
HSLANAFYCQCLPGHTGQWCEVELDPCQSQPCSHGGSCEATAGPPPGFTCHCPQGFEGPT
CSHRAPSCGLHHCHHGGLCLPSHKPGFPPRCACLNGYGGPDCLTPPVPPGCGPPSPCLHN
GSCSETPGLGGPGFRCSCPPSSPGPRCQRPAKGCEGRSGDGACDAGCSGPGGNWCGDCSL
GVDPGCSHSCLLFDGQCHPQCDSEECLFDGYDCETPPACTPAYDQYCRDHFHNGHCEKGC
NTAECGWDGGDCRPEDGDSEWGPSLALLVVLSPSTLDQQLLALARVLSLTLRVGLWVRKD
RDGRNMVYPYPGAQAEEELGGAPDPSHHERATPQTQPTGKEADSLSTGFVVVMDVDLSRC
GPDHPASRCPWDPGLLLRFLAAMAAVGALEPLLPGPLLAAHPRAGTEPPANQLPWPVLCS
PVAGVLLLALGALLVLQLIRRKRREHGALWLPPGFTRRSQTQPVPRRRRPPLGEDSIGLK
ALKPEAEVDEDGVVMCSGPKEGEEADQAEEMASPSKCQLWPLSSDCQELPQAAMLTPPQD
SEMDVPDVDTRGPDGVTPLMSAVCCGGVEPRTYQETWLGSPEPWEPLLGGGACPQVHTVG
TGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLLLRSRQT
AIDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNNARAARS
LLQAGADKDALDGREQTPLFLAAREGAMEVAQLLLGLGAARGLRDQAGLAPGDIARQRNH
WDLLTLLEGAGPPEARHKATPGRGAGALQRARTASGSVPPRGGGAQPRCRTLSAGAYPQA
RTLSVDLAAHGGGAYSHCRSLSKGAGEGPPLRGRRFSAGMRGPPSNPAIVXXSGVAAGSG
GVASAVDWPCDWVALGACGPASNTPIPPPCLTPSPERGSPQVAWGPPAHQVIPLNAGGEG
EK
Download sequence
Identical sequences ENSTTRP00000013087 ENSTTRP00000013087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]