SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013091 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013091
Domain Number 1 Region: 1022-1152
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.19e-45
Family Regulator of G-protein signaling, RGS 0.00000618
Further Details:      
 
Domain Number 2 Region: 101-228
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.53e-20
Family Synaptotagmin-like (S variant) 0.0035
Further Details:      
 
Domain Number 3 Region: 261-341
Classification Level Classification E-value
Superfamily PDZ domain-like 3.73e-17
Family PDZ domain 0.0000177
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013091
Domain Number - Region: 553-622
Classification Level Classification E-value
Superfamily PH domain-like 0.000779
Family Pleckstrin-homology domain (PH domain) 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013091   Gene: ENSTTRG00000013802   Transcript: ENSTTRT00000013802
Sequence length 1158
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1552:10255:133862:1 gene:ENSTTRG00000013802 transcript:ENSTTRT00000013802 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PHTDNASLPSSPAGFYPPECICRLLTASVQGGLPCRCYSGPSCEGVYSTSSLRVLSESCG
LSLRLPVFLGWMEWQSRDTSLPRKDAWTQTSPARRRIRPAQVQGAGQLKLSIDAQDPGLL
LHIIEGKGLVSKEPGVCDSYVKISLVPEDNRLRCQKTQTIPDSRDPVFHEHFFLPVQEED
EQKRLLVTVWNRAGDSRQSGLIGCMSFGVKSLLTPDKETSGWYYLLGEDLGRTKHLKVAR
RRLRPLRDPLLRLLGGEDTENREKLKITIPRGKDGFGFTICCDSPVRVQAVDSGGPAERA
GLQQLDTVLQLNERPVEHWKCVELAHEIRSCPSEIILLVWRMVPQVKPGPDGGVLRRASC
KSTHDLQSPPNKREKNCTHGAQARPEQRHSCHLVCDSSDGLLLGGWERYTEVTKRGGQHT
LPALSRATAPADPNYIILAPLNPGSQLLRPVYQEDAIPEESGSPSKGKSYTGLGKKCRLM
KTVQTMKGHGNYQNCPVMRPHAPHSSYGTYVTLAPKVLVFPIFVQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXVTLFAYSDLLLFTKEDEPGRCNVLRNPLYLQSVKLQEGSSEDLKFCV
LYLAEKAECLFTLEAHSHEQKKRVCWCLSENIAKQQQLAAPSPESKMFETEADEKREMPL
ERKGPGAEDPSPSKDPSRGQDPPPGQDLPPKEDSSSSQEPSAGPESPTSKDSPSCKESPP
GQEPLPSKDSSPCQEHPTAPAFSPCQDLPAGQELSPSQDPLISKHLPDIQEPPAQDLLPH
QDLPASQDPLAAEPLAKETTSSGDPPAATGGSPMASRPNFVIPEVRLDSTYSQKAGAEGG
SSGDEEDAEEAEEGEEDEDEDTSDDNYGERGEAKRSSMIETGQGAEGGLSLRVQNSLRRR
THSEGSLLQEARGPCFASDTTLHCSDGEGTASTWAMPSPRTLKKELGRNGGSMHHLSVFF
TGHRKMSGADTAGDDDDASRKRKSKNLAKDMKNKLGIFRRRNESPGAQPAGKADKVTKSF
KPTSEEALKWGESLEKLLVHKYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMAA
KAKKIFAEYIAIQACKEVNLDSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFL
RSDLYLDLINQKKMSPPL
Download sequence
Identical sequences ENSTTRP00000013091 ENSTTRP00000013091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]