SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013103 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013103
Domain Number 1 Region: 198-410
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-59
Family DBL homology domain (DH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 393-555
Classification Level Classification E-value
Superfamily PH domain-like 1.93e-34
Family Pleckstrin-homology domain (PH domain) 0.0026
Further Details:      
 
Domain Number 3 Region: 577-737
Classification Level Classification E-value
Superfamily PH domain-like 7.99e-22
Family Pleckstrin-homology domain (PH domain) 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013103   Gene: ENSTTRG00000013816   Transcript: ENSTTRT00000013815
Sequence length 766
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1555:95803:149962:1 gene:ENSTTRG00000013816 transcript:ENSTTRT00000013815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEEVKPASASCVSKEKPSKISDLISRFEGGSSLSNYSDLKKDSAVNLNAPRTPRRHGLTT
TPQQKLLSQHSPQKQGNDTDQSQGAQTCVANGMVAAQNQMECEEDKAATLSPDTPIQTSE
PLPDTNLVNGERQETATDPASPTTNDCDENASDSSCRTLHVGPRLPLEEGRADTEAKVQE
REDGESPLELEQLDQHHEMKETNEQKLHKIANELLLTERAYVSRLDLLDQVFYCKLLEEA
NRGSFPAEMVNKIFSNISSINAFHSKFLLPELEKRMQEWETTPRIGDILQKLAPFLKMYG
EYVKGFDNAMELVKNMTERIPQFKSIIEEIQKQKICGSLTLQHHMLEPVQRIPRYEMLLK
DYLRKLPPGSPDWNDAKKSLEIISTAASHSNSAIRKMENLKKLLEIYEMLGEEEDIVNPS
NELIKEGQILKLAARNTSAQERYLFLFNNMLLYCVPRFSLVGSKFTVRTRVGIDGMKIVE
THNEEYPHTFQVSGKERTLELQASSEQDKEEWIKALQETIDAFHQRHETFRNAIAKDNDI
HSEVSTAELGKRAPRWIRDNEVTMCMKCKEPFNALTRRRHHCRACGHVVCWKCSDYKAQL
EYDGGKLSKVCKDCYQIISGFTDSEEKKRKGILEIESAEVSGNSVVCSFLQYMEKSKPWQ
KAWCVIPKQDPLVLYMYGAPQDVRAQATIPLLGYIVDDMLRSADLPHSFKLTQSKSVHSF
AADSEELKQKWLKIILLAVTGETPDGPSKHPATLDDHPEPKRKSEC
Download sequence
Identical sequences ENSTTRP00000013103 ENSTTRP00000013103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]