SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013138 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013138
Domain Number 1 Region: 1443-1691
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.84e-40
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number 2 Region: 676-823,857-904
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-32
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 3 Region: 43-188,261-330
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.59e-30
Family Voltage-gated potassium channels 0.015
Further Details:      
 
Domain Number 4 Region: 1120-1275,1352-1392
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-29
Family Voltage-gated potassium channels 0.022
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013138
Domain Number - Region: 1698-1745
Classification Level Classification E-value
Superfamily EF-hand 0.00351
Family Calmodulin-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013138   Gene: ENSTTRG00000013854   Transcript: ENSTTRT00000013854
Sequence length 1901
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_788:535216:622049:1 gene:ENSTTRG00000013854 transcript:ENSTTRT00000013854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LFPQTFVVLNRGKTLFRFSATPALYILSPFNLIRRIAIKILIHSLFSMIIMCTILTNCVF
MTFSNPPEWSKNVEYTFTGIYTFESLVKIIARGFCIDGFTFLRDPWNWLDFSVIMMAYIT
EFVNLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALI
GLQLFMGNLRNKCVVWPINFNESYLENGTKGFDWDEYINNRTNFYTVPGMLEPLLCGNSS
DAGQCPEGYQCMKAGRNPNYGYTSFDTFSWAFLALFRLMTQDYWENLYQLTLRAAGKTYM
IFFVLVIFVGSFYLVNLILAVVAMAYEEQNQATLEEAEQKEAEFKAMLEQLKKQQEEAQA
AAMATSAGTVSEDAIEEEGEEGAGSPRSSSEISKLSSKSAKERRNRRKKRKQKELSEGEE
KGDPEKVFKSESEDGMRRKGFRLPDNRIGRKFSIMNQSLLSIPGSPFLSRHNSKSSIFSF
RGPGRFRDPGSENEFADDEHSTVEESEGRRDSLFIPIRARERRSSYSGYSGYSQGSRSSR
IFPSLRRSVKRNSTVDCNGVVSLIGGPGSHISGRLLTEVKIDKAATDDSATTEVEIKKKG
PGSLLVSMDQLASYGRKDRINSILSVVTNTLVEELEESQRKCPPCWYKFANTFLIWECHP
YWIKLKEIVNLIVMDPFVDLAITICIVLNTLFMAMEHHPMTPQFEHVLTVGNLVFTGIFT
AEMFLKLIAMDPYYYFQEGWNIFDGFIVSLSLMELSLADVEGLSVLRSFRLLRVFKLAKS
WPTLNMLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKECVCKINQDCELPRW
HMHDFFHSFLIVFRVLCGEWIETMWDCMEVAGQAMCLIVFMMVMVIGNLVVLNLFLALLL
SSFSADNLAATDDDGEMNNLQISVIRIKKGVAWTKLKVRAFMQAHLKQREADEVKPLDEL
YEKKANCIANHTGADIHRNGDFQKNGNGTTSGIGSSVEKYIIDEDHMSFINNPNLTVRVP
IAVGESDFENLNTEDVSSESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDP
DACFTEGCVQRFKCCQVNIEEGLGKSWWILRKTCFLIVEHNWFETFIIFMILLSSGALAF
EDIYIEQRKTIRTILEYADKVFTYIFILEMLLKWIAYGFVKFFTNAWCWLDFLIVAVSLV
SLIANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIF
WLIFSIMGVNLFAGKYHYCFESSEIRFEIDVNNKTECEKLMXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXPDEQPKYEDNIYMYIYFVIFIIFGSFFTLNLF
IGVIIDNFNQQKKKFGGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKIQGIVFDFV
TQQAFDIVIMMLICLNMVTMMVETDTQSKQMENILYWINLVFVIFFTCECVLKMFALRHY
YFTIGWNIFDFVVVILSIVGMFLADIIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRT
LLFALMMSLPALFNIGLLLFLVMFIFSIFGMSNFAYVKHEAGIDDMFNFETFGNSMICLF
QITTSAGWDGLLLPILNRPPDCSLDKEHPGSGFKGDCGNPSVGIFFFVSYIIISFLIVVN
MYIAIILENFSVATEESADPLSEDDFETFYEIWEKFDPDATQFIEYSKLADFADALEHPL
RVPKPNTIELIAMDLPMVSGDRIHCLDILFAFTKRVLGDSGELDILRQQMEERFVASNPS
KMSYEPITTTLRRKQEEVSAVVLQRAYRGHLARRGFVCKKTTSNKLENGGAHREKKESTP
STASLPSYDSVTKPEKEKQQRAEEGRRERARRQKEVRESKC
Download sequence
Identical sequences ENSTTRP00000013138 ENSTTRP00000013138

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]