SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013153 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013153
Domain Number 1 Region: 186-439
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 5.76e-45
Family Voltage-gated potassium channels 0.0013
Further Details:      
 
Domain Number 2 Region: 7-112
Classification Level Classification E-value
Superfamily POZ domain 3.4e-33
Family Tetramerization domain of potassium channels 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013153   Gene: ENSTTRG00000013876   Transcript: ENSTTRT00000013870
Sequence length 511
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1205:41848:76027:1 gene:ENSTTRG00000013876 transcript:ENSTTRT00000013870 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQGDESERIVINVGGTRHQTYRSTLRTLPGTRLAWLAEPDAHSHFDYDPRADEFFFDRH
PGVFAHILNYYRTGKLHCPADVCGPLYEEELAFWGIDETDVEPCCWMTYRQHRDAEEALD
SFGGAPLDNSADDADADGPGDSGDGEDELEMTKRLALSDSPDGRPGGFWRRWQPRIWALF
EDPYSSRYARYVAFASLFFILVSITTFCLETHERFNPIVNKTEIENVRNGTQVRYYREAE
TEAFLTYIEGVCVVWFTFEFLMRVVFCPNKVEFIKNSLNIIDFVAILPFYLEVGLSGLSS
KAAKDVLGFLRVVRFVXXXXXXXXXXXXXXXXXXXXXXXXXXNEFLLLIIFLALGVLIFA
TMIYYAERIGAQPNDPSASEHTHFKNIPIGFWWAVVTMTTLGYGDMYPQTWSGMLVGALC
ALAGVLTIAMPVPVIVNNFGMYYSLAMAKQKLPKKKKKHIPRPPQLGSPNYCKSVVNSPH
HSTQSDTCPLAQEEILEINRAGRKPLRGMSI
Download sequence
Identical sequences ENSTTRP00000013153 ENSTTRP00000013153

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]