SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013217 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013217
Domain Number 1 Region: 150-323,376-569
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 8.18e-91
Family Phosphonoacetate hydrolase 0.011
Further Details:      
 
Domain Number 2 Region: 646-912
Classification Level Classification E-value
Superfamily His-Me finger endonucleases 1.24e-35
Family DNA/RNA non-specific endonuclease 0.0081
Further Details:      
 
Domain Number 3 Region: 56-102
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.0000000445
Family Somatomedin B domain 0.0017
Further Details:      
 
Domain Number 4 Region: 104-144
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000432
Family Somatomedin B domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013217   Gene: ENSTTRG00000013931   Transcript: ENSTTRT00000013938
Sequence length 914
Comment pep:known_by_projection scaffold:turTru1:scaffold_115191:53876:128784:-1 gene:ENSTTRG00000013931 transcript:ENSTTRT00000013938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRNSCQLYQVISLFTFAVGVNICLGFTANRIKRAEGWDEGPPTVLSDSPWTNTSGSCKG
RCFELQEVGPPDCRCDNLCKSYSSCCHDFDELCLKTAGGWECTKDRCGEVRNEDNACHCS
EDCLAKGDCCTNYQVVCKGESHWVDDDCEEIKAPECPAGFVRPPLIIFSVDGFRASYMKK
GSKVMPNIEKLRSCGTHSPYMRPVYPTKTFPNLYTLATGLYPESHGIVGNSMYDPVFDAT
FHLRGREKFNHRWWGGQPLWITATKQGVKAGTFFWSVMIPHERRILTILQWLTLPDNERP
SVYAFYSEQPDFSGHKYGPFGPEDSSYGSPFTPAKRPKRKVTPKRRQERPVTPPKKRRRK
LHRMDHYAAETRQDKMTNPLRDIDKTVGQLMDGLKQLKLHRCVNVIFVGDHGMEDVTCDR
TEFLSNYLTNVDDITLVPGTLGRIRPKFSNNAKYDPKVIIANLTCKKPDQHFKPYMKQHL
PKRLHYANNRRIEDIHLLVDRRWHVARKPLDVYKKPSGKCFFQGDHGFDNKVNSMQTVFV
GYGPTFKYKTKVPPFENIELYNVMCDLLGLKPAPNNGTHGSLNHLLRTNTFRPTMPEEVT
RPSYPGIMYLQSDFDLGCTCDDKVEPKNKLDELNKRLHIKGSTEERHLLYGRPAVLYRTR
YDILYHTDFESSYSEIFLMPLWTSYTVSKQAEVSGIPEHLTNCVRPDVRVSPSFSQSCLA
YKNDKQMSYGFLFPPYLSSLPETKYDAFLVTNMVPMYPAFKRVWNYFQRVLVKKYASERN
GVNVISGPIFDYDYDGLHDTQDKIKQYVEGSSIPVPTHYYSIITSCLDFTQPADKCDGPL
SVSSFVLPHRPDNDESCNSSEDESKWVEELIKMHTARVRDIEHLTSLDFFRKTSRSYPEI
LTLKTYLHTYESEI
Download sequence
Identical sequences ENSTTRP00000013217 ENSTTRP00000013217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]