SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013219 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013219
Domain Number 1 Region: 19-147
Classification Level Classification E-value
Superfamily Lysozyme-like 3.75e-55
Family C-type lysozyme 0.000000693
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013219   Gene: ENSTTRG00000013948   Transcript: ENSTTRT00000013940
Sequence length 148
Comment pep:known_by_projection scaffold:turTru1:scaffold_114746:182136:187936:1 gene:ENSTTRG00000013948 transcript:ENSTTRT00000013940 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKAVLILGLLLLSVAVQGKTFERCELARTLKRLGLDGYRGVSLANWMCLAKWESNYNTQA
TNYNPGSRSTDYGIFQINSRYWCNDGKTPRAHNACGIPCSALLKDDITDAVRCAKRVVRD
PQGIRAWVAWRSHCQNQDLRTYVQGCGV
Download sequence
Identical sequences A0A077SA04
ENSTTRP00000013219 XP_004317869.1.83887 ENSTTRP00000013219

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]