SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013319 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013319
Domain Number 1 Region: 19-291
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 2.11e-92
Family (Glycosyl)asparaginase 0.0000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013319   Gene: ENSTTRG00000014050   Transcript: ENSTTRT00000014046
Sequence length 305
Comment pep:known_by_projection scaffold:turTru1:scaffold_111270:38460:59298:-1 gene:ENSTTRG00000014050 transcript:ENSTTRT00000014046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNPAVVVVHGGGGSNISKDRKERVRQGIVKAATVGYNILKEGGSAVDAVEGAVTVLEDDP
EFNAGCGSVLNEDGEVEMDASIMNGKDLSAGAVSAVRCVANPIKVARLVMEKTPHCFLTD
QGAAKFAAASGIPTIPGEQLVTERNKKRLENEKLQKSDYQKNLGTVGAVAVDCRGNVAYA
TSTGGVVNKMLGRVGDTPCIGSGGYADNDIGAVSTTGHGESILKVNLARLTLFHVEQGKT
LEEAADASLGYMKSKVKGVGGVILVNKAGDWAVKWTSTSMPWGAAKDGKLYSGIDLGDTS
ITDLP
Download sequence
Identical sequences ENSTTRP00000013319 ENSTTRP00000013319 XP_004330931.1.83887

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]