SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013452 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013452
Domain Number 1 Region: 124-646
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 4.24e-120
Family Gamma-glutamyltranspeptidase-like 0.000000833
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013452   Gene: ENSTTRG00000014183   Transcript: ENSTTRT00000014186
Sequence length 652
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1251:46809:69214:-1 gene:ENSTTRG00000014183 transcript:ENSTTRT00000014186 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAENEASQESALGAYSPVDYMSITSFPRLPEDEPAPAAPLRSRKDEDAFLGDPDTDPDS
FLKSARLQRLPSSSSEMGSQDGSPLRETRKDPFSAAASECSCRQDGLTVIVTACLTFATG
VTVALIMQIYFGDPQIFHQGAVVTDAAHCTSLGIEVLNKQGSSVDAAVAAALCLGIVAPH
SSGLGGGGVMLVHDIRRNKSHLIDFRESAPGALREEALQRSWETKPGLLVGVPGMVKGLH
EAHQLYGRLPWSQVLAFAAAVAQDGFNMTHDLAQALAEQPPPNASERFRETFLPLGHPPL
PGSLLRRPDLAAVLDVLGTYGPAAFYAGGNLTLEMVAEAQHAGGVITEEDFSNYSALLEK
PVCGVYRGHLVLSPRPPHTGPALISALNILEGFNLTSLVSREQALHWVAETLKIALALAS
RLGDPVYDSTITESMDDMLSKVEAAYFRGQINDSQTAPVPLLPIYELNGAPTAAQVLIMG
PDDFIVAMVSSLNRPFGSGLITPSGILLNSQMLDFSWPNRTANHPAPSLENSVQPGKRPL
SFLLPTVVRPAEGLCGTYLALGANGAARGLSGLTQVLLNVLTLNRNLSDSLARGRLHPDE
FTEEEIEFLEARGHHVEKVDVLSWVHGSRRTNNFIIGVKDPRSPDAAGATIL
Download sequence
Identical sequences ENSTTRP00000013452 ENSTTRP00000013452

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]