SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013493 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013493
Domain Number 1 Region: 256-438
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.5e-30
Family Clostridium neurotoxins, the second last domain 0.089
Further Details:      
 
Domain Number 2 Region: 1523-1597
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000292
Family Complement control module/SCR domain 0.0023
Further Details:      
 
Domain Number 3 Region: 683-828
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000004
Family Matrix metalloproteases, catalytic domain 0.083
Further Details:      
 
Domain Number 4 Region: 1589-1646
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000806
Family Complement control module/SCR domain 0.0057
Further Details:      
 
Domain Number 5 Region: 1479-1529
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000264
Family Complement control module/SCR domain 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013493
Domain Number - Region: 538-630,720-764
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00012
Family Zinc protease 0.079
Further Details:      
 
Domain Number - Region: 1044-1106
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00187
Family Fibronectin type III 0.01
Further Details:      
 
Domain Number - Region: 1402-1466
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00657
Family Complement control module/SCR domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013493   Gene: ENSTTRG00000014214   Transcript: ENSTTRT00000014232
Sequence length 1789
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_933:70564:323760:1 gene:ENSTTRG00000014214 transcript:ENSTTRT00000014232 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMCLKILRISLVILAGWALSTVSSELGWTRKRSLAQRGHLNQVLLEGERCWLGARVRRPR
AAPQHHLFGVYPSRPGNYLRPYPAGDQGMYHAGRSKPDAEGMAVRSVPPDLTGSAGVTSE
AERPAALWVEDGPIGQSELLGDDDTYLGNQGSKEPLGEAGTQEHGALAAAKITTFPRQKE
PGPETQRKGRTKTRRRRQVAKGQAGGVQGDPSVVPRHFQPWSKHPLMHGVRTSSSEGGIQ
NGGGDPDWEAETFSPQGGLPVLYFSGRREQLLLRPEVLADIPREAFTVEAWVKPEGGQNS
PAIIAGVFDNCSHTISDKGWALGIRSGKDVGRRDARFFFSLRTDRVKKATIMMGHGRYQP
GKWTHVAATYDGRRMALYVDGTQVASSPDQSGPLNSPFMASCRSLFLGGDSSEDGHHFRG
HLGTLVFWSTALPQSHLQHSPQQPSEVEDLTTLLLTASFEPLEEQWAPFRDGKYPRLEVL
QGFEPEPEILSPLQPPLCGQTACDNVELISQYSWHWPLRGEKVIRYQVVNICNDEGLNPT
VSEEQISRQHEVLNEAFSRYNISWQLHIHQVHNSTLRHRVVLVNCEPSKIGNDHCDPECE
HPLTGYDGGDCRLQGRCYSWNRRDGICHVECNNMLNDFDDGDCCDPEGADVHKTCFDPDS
PRRAYMSVKELKEALQLNSTHFLNVYFASSVREDLAGAATWPWDKEAISHLGGVVLNPAY
YGMPGHTNIMIHEVGHVLGLYHVFKGVSERESCDDPCRETVPSMDTGDLCADTAPTPKSK
LCQDPEPINDTCGFTHFPGAPFSNYMSYTDDDCTDSFTPNQVARMHCYLDLVYQQWSQSR
KPTPIPIPPMVIGQTPLSLTIHWLPPISGVVYDRVPGSVCGACTEEGTFRQYVHTASSRR
VCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPELHLYHMNMTVPCPAEGCSLELLFQHPV
QADTLTLWVTYLSMDSSQALFDTEILLEHQESVHLGPLDTFCDTPLTIKLHVDGKVLGVK
VYTFDERMEIDAALLTSQPHSPLCSGCRPVRYQVLREPPFASGLPMVVTHPHRKFTDVEV
TPGQMYRYQVQAAAGTELGEASPPLSHIHGAPYCGDGKVARSLGEECDDGDLLSGDGCSR
ACELEEGFNCVGEPSLCYIYEGDGICEPFEKETSITDCGLYTPKGYLDQWATQAYSSHED
KKKCPVSLVTGEPPSMICTSYRPDLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXVCFNRPGVATAIFIFLTSDGLVPGERQRPTVTLYLTDFSGNNHSLGSYELSCQHN
PLVINVTHHSNVLFHHTTSVLLNFSSPLVGISAVALRTSSIISPSASNNCIPEHEGQNHQ
GQSCVHRPCGEQGSCVPLLLDHADVVNCTSGGPGHMKCSITCQRGFDLQASNGQYLRPMQ
KEILLTCSSGHWDRAVSCMPLDCGVPDQSLVNYANFSCSEGTNFLKRCSISCVPPAKLQG
LSPWLTCLEDGLWSLPEAYCKLECDVPPVIPNANLLLPHCLQGNHDVGSICRYKCKPGYY
VMGSAENKVRNKFLKIQCLEDGIWEQGSCVPVVCEPPSPVFEGMYECTNGFELNSQCVLN
CNEESKRHPILCTKEGLWTEEFKLCENLQGECPPPTSELNFVEYKCEQGYRIGAVCSPSC
IIPPSDPVILPENVTADTLEHWMEPVKVQSIVCTGRRQWHPDPLLIHCQSCEPFQADGWC
DTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENL
Download sequence
Identical sequences ENSTTRP00000013493 ENSTTRP00000013493

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]