SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013513 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013513
Domain Number 1 Region: 4-132
Classification Level Classification E-value
Superfamily PH domain-like 2.34e-55
Family Necap1 N-terminal domain-like 0.00000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013513   Gene: ENSTTRG00000014260   Transcript: ENSTTRT00000014257
Sequence length 275
Comment pep:known_by_projection scaffold:turTru1:scaffold_91199:49566:59756:1 gene:ENSTTRG00000014260 transcript:ENSTTRT00000014257 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAELEYESVLCVKPDVSVYRIPPRASNRGYRASDWKLDQPDWTGRLRITSKGKIAYIKL
EDKVSGELFAQAPVEQYPGIAVETVTDSSRYFVIRIQDGTGRSAFIGIGFSDRGDAFDFN
VSLQDHFKWVKQESEISKESQEMDNRPKLDLGFKEGQTIKLSIGNITTKKGGASRPKTTA
AGGLSLLPPPPGGRVTIPPPSSSVAISNHVTPPPVPKSSHGGTDADILLDLDSPAPVTTP
APAPVSASNDLWGDFSTASSSVPNQAPQPSNWVQF
Download sequence
Identical sequences XP_004279144.1.21590 XP_004318881.1.83887 XP_007469429.1.90284 ENSTTRP00000013513 ENSTTRP00000013513

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]