SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013607 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013607
Domain Number 1 Region: 175-351
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.84e-25
Family DBL homology domain (DH-domain) 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013607   Gene: ENSTTRG00000014351   Transcript: ENSTTRT00000014352
Sequence length 366
Comment pep:known_by_projection scaffold:turTru1:scaffold_115774:356182:376225:1 gene:ENSTTRG00000014351 transcript:ENSTTRT00000014352 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSMIQAITSKQEEMQQKIEQLQQEKRRESRKVKAKKTQKEEHGSQAGPAQAQGSPFRSIN
IPEPVLPSEDFTNLLPSQAYEKAQEARSMHVADSNVKGMMGPGMNPTTPEAEENLKTCLS
ADIQHKGHLPPGVWRQPKDSKEWGEEYVTKDHPDKLKEAGQGRHSSLENILCETSLAAKR
QTVALELLESERKYVINISLILKIKATFQGSDGKRNAKERSLFPGSLRYLVQQHLDLLHA
LQERVLKWPRQGVLGDLFLKLTNDENNFLDYYVAYLRDLPECISLVHVVVLKEGDEEIKS
DIYTLFFHIVQRIPEYLIHLQNVLKFTEQEHPDYYLLLVCVQRLRVFISHYTLLFQCNED
LLIQKR
Download sequence
Identical sequences ENSTTRP00000013607 ENSTTRP00000013607

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]