SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013627 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013627
Domain Number 1 Region: 538-1014
Classification Level Classification E-value
Superfamily Ras GEF 6.28e-142
Family Ras GEF 0.0000000000000115
Further Details:      
 
Domain Number 2 Region: 2-148
Classification Level Classification E-value
Superfamily Histone-fold 5.45e-50
Family TBP-associated factors, TAFs 0.000000347
Further Details:      
 
Domain Number 3 Region: 169-371
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.81e-43
Family DBL homology domain (DH-domain) 0.00000000284
Further Details:      
 
Domain Number 4 Region: 389-544
Classification Level Classification E-value
Superfamily PH domain-like 6.03e-39
Family Pleckstrin-homology domain (PH domain) 0.000000458
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013627   Gene: ENSTTRG00000014368   Transcript: ENSTTRT00000014372
Sequence length 1304
Comment pep:known_by_projection scaffold:turTru1:scaffold_115774:404283:484665:-1 gene:ENSTTRG00000014368 transcript:ENSTTRT00000014372 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VQGQVHPTLESSDDALQYVEELILQLLNMLCQAQPRSASDVEERVQKSFPHPIDKWAIAD
AQSAIEKRKRRNPLSLPVEKIHPLLKEVLGYKIDHQVSVYIVAVLEYISADILKLVGNYV
RNIRHYEITKQDIKVAMCADKVLMDMFHQDVEDINILSLTDEEPSTSGEQTYYDLVKAFM
AEIRQYIRELNLIIKVFREPFVSNSKLFSANDVENIFSRIVDIHELSVKLLGHIEDTVEM
TDEGSPHPLVGSCFEDLAEELAFDPYESYARDILRPGFHDRFLSQLSKPGAALYLQSIGE
GFKEAVQYVLPRLLLAPVYHCLHYFELLKQLEEKSEDQEDKECLKQAITALLNVQSGMEK
ICSKSLAKRRLSESACRFYSQQMKGKQLAIKKMNEIQKNIDGWEGKDIGQCCNEFIMEGT
LTRVGAKHERHIFLFDGLMICCKSNHGQPRLPGASNAEYRLKEKFFMRKVQINDKDDTNE
YKHAFEIILKDENSVIFSAKSAEEKNNWMAALISLQYRSTLERMLDVTMLQEEKEEQMRL
PSADVYRFAEPDSEENIIFEENVQPKAGIPIIKAGTVIKLIERLTYHMYADPNFVRTFLT
TYRSFCKPQELLSLIIERFEIPEPEPTEADRIAIENGDQPLSAELKRFRKEYIQPVQLRV
LNVCRHWVEHHFYDFERDADLLQRMEEFIGTVRGKAMKKWVESITKIIQRKKIARDNGPG
HNITFQSSPPTVEWHISRPGHIETFDLLTLHPIEIARQLTLLESDLYRAVQPSELVGSVW
TKEDKEINSPNLLKMIRHTTNLTLWFEKCIVETENLEERVAVVSRIIEILQVFQELNNFN
GVLEVVSAMNSSPVYRLDHTFEQIPSRQKKILEEAHELSEDHYKKYLAKLRSINPPCVPF
FGIYLTNILKTEEGNPEVLKRHGKELINFSKRRKVAEITGEIQQYQNQPYCLRVESDIKR
FFENLNPMGNSMEKEFTDYLFNKSLEIEPRNPKPLPRFPKKYSYPLKSPGVRPSNPRPGT
MRHPTPLQQEPRKISYSRIPESETESTASAPNSPRTPLTPPPASGASSTTDVCSVFDSDH
SSPFHSSSDTVFIQVTLPHGPRSASVSSISLTKSTDEVPVPPPVPPRRRPESAPAESSPS
KIMSKHLDSPPAIPPRQPTSKAYSPRYSVSDRTSISDPPESPPLLPPREPVRTPDVFSSS
PLHLQPPPLGKKSDHSNAFFPNSPSPFTPPPPQTPSPHGTRRHLPSPPLTQEVDLHSIAG
PPVPPRQSTSQHIPKLPPKTYKREHTHPSMHRDGPPLLENAHSS
Download sequence
Identical sequences ENSTTRP00000013627 ENSTTRP00000013627

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]