SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013647 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000013647
Domain Number - Region: 546-577,716-743
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.00209
Family Anti-sigma factor antagonist SpoIIaa 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013647   Gene: ENSTTRG00000014382   Transcript: ENSTTRT00000014392
Sequence length 956
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2119:204318:268350:-1 gene:ENSTTRG00000014382 transcript:ENSTTRT00000014392 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMQPERSFQSLGSRYRQNSFMYDVKRDVYNEENFQQEYRRKTAFSGKLDIDISTVSHHVQ
CRCSWYKFRRCMLTIFPFLEWMCFYRFKDWLLGDLLAGISVGLVQVPQXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXTFFLVSALTINVLRTYPFNGGHVILGTFIKDD
FSNLSFFENYNKSLSVMASTTLLTEIIQLSMGMLGFGFIITYIPEAAISAYLAATALHIM
LSQMTCIFGIMISFHSGPISFFYNIINYCIGLPKANSTSILLFLTAIVALRINKCIRISY
NQYPIKFPMEIFLILGFAAFANKVNVDTENSKMLIDMIPYSFLFPVTPDMSNLTEVLLEA
FSLALVSSSLLIFLGRKIASFHNYDVNSNQDLIAIGLCNVVSSFFRSYVFTGAVVRTIIQ
DKTGGRQQFASLVGAVVMLLLMVKVGRFFYKLPNAVLAGIILSNVLPYLETIYNLPNLWR
QNQYDCLIWMVTFISAILLGLDMGLLVSVAFTFFIITVQSHRTKILLLGQIPNTNIYRSF
HDYQEVTNIPGVKIFQCCNSITFVNVHYLKRKLLEGVEMVKVPLTEEEIYSLFNQNEDGP
QQGKLCWCFCNCDEPEPPPRVVYTERFESKGDLDSSSSINLVRCSRFKIMDTSQTMSDHQ
VPYITSSTSQRNPNYKEVEKVWLSDDPSRSMSITLPDASETQVGGRTLLPYSTSSLLPSI
HTIILDFSMVHLVDAQALVVLRQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKEESKHKMSSRLIEAPR
SKSPAFIRTQEEESELDFDLYPMQESEQETGLDPDLDLDHEMEPESELEPESELDPETET
KPESTSRPSSQQQYPLYQFITPQSPPQTQPRTQSVESRHQLMNSLTSQSNASEDTL
Download sequence
Identical sequences ENSTTRP00000013647 ENSTTRP00000013647

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]