SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013712 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013712
Domain Number 1 Region: 149-368
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.88e-47
Family DBL homology domain (DH-domain) 0.00039
Further Details:      
 
Domain Number 2 Region: 371-502
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-21
Family Pleckstrin-homology domain (PH domain) 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013712   Gene: ENSTTRG00000014463   Transcript: ENSTTRT00000014463
Sequence length 785
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_42:64:14793:1 gene:ENSTTRG00000014463 transcript:ENSTTRT00000014463 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHAFGPPNGGRLQGLVASRIETYGGRLRASTLSTPGSLCPRGGPVLDPSGRHLQGYAPFT
KGSGPARGLSPLRLREPEPEKRHGGPFGAGTPHFPKLKEVTRAHQLEMSLHTFSMFGMPR
LPPDRRYEIGDDGDSSLAIENLWNDLLPVNKEMSRELCHQQEALWELLTTELIYVRKLKI
MTDLLAAGLLNLQRVGLLTEVSAETLFGNVPSLIRTHQSFWEEVLGPTLEETRASGQPLD
PVSLQNGFLSFSQRFQPYVLYCLRVKQTMAYAQQDNNPLFRFLQCCEKHKRSGRQTLGDL
LIKPHQRITKYPLLLQAVLKRSPEARAREALTAMIAAVESFLRHINKQVRQREEQESLAA
AAQRIGPYEVLEPSSEEVEKNLRPFSTLDLTAPMLGVPPEHTRQLLLEGPVRMKEGREGK
LDVYLFLFSDVLLVTKPLRRTDKAKVIRPPLMLEKLVCRSLRDPSSFLLIHLTELQCVSS
ALTVHCPSAADRAVWLERTQQAQVTLQKLKAEEYIQQKRELLALYQDRDGESPGPRPSMP
SVEGSESSTEGRTPGSSIVIPQLVVTEDTDEDAPLVPDDISDSGYGTLVPGSPKASHFLP
NRLRSKVLRRDPRRTFSTLDLRDVPLHLQPPDPQAPQRRSTPELPEASVQKGDSLPRGDP
PTWSEEEGGTSVGENVVVETLHRARLRWQLSPSLTHTDSSGESPWESSGDEEEGPFLGPG
YSPSPHPLWAEDMLREIREELASQRIERVPEPGDSRPRKLTRVQLQRMRGLHVIRLDTPL
SASEV
Download sequence
Identical sequences ENSTTRP00000013712 ENSTTRP00000013712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]