SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013753 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013753
Domain Number 1 Region: 647-800
Classification Level Classification E-value
Superfamily C-type lectin-like 3.67e-42
Family C-type lectin domain 0.00000516
Further Details:      
 
Domain Number 2 Region: 140-255
Classification Level Classification E-value
Superfamily C-type lectin-like 7.53e-41
Family Link domain 0.0049
Further Details:      
 
Domain Number 3 Region: 256-349
Classification Level Classification E-value
Superfamily C-type lectin-like 3.48e-30
Family Link domain 0.0067
Further Details:      
 
Domain Number 4 Region: 800-859
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000244
Family Complement control module/SCR domain 0.0033
Further Details:      
 
Domain Number 5 Region: 89-144
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000282
Family I set domains 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013753   Gene: ENSTTRG00000014506   Transcript: ENSTTRT00000014506
Sequence length 898
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1301:33106:46053:1 gene:ENSTTRG00000014506 transcript:ENSTTRT00000014506 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPSLPLLATLALAWVPAALADALEGDSSEDAFRVRIAGVRPQPTGGPSPIPCVYRSPQ
RAAPGSPRKLLSGGREAEVLVARGLRVKVSEAYRFRVALPAYPASLTDVSLVLSELRPND
SGIYRCEVQHGIDDSSDAVEVKVKGVVFLYREGSARYAFSFAGAQEACARIGARIATPEQ
LYAAYLGGYEQCDAGWLSDQTVRYPIQTPREACYGDMDGFPGVRNYGVVDPDDLYDVYCY
AEELNGELFLGAPADKLTLEEARAYCQERGAKIATTGQLYAAWDGGLDRCSPGWLADGSV
RYPIVTPSQRCGGGLPGVKTLFLFPNQTGFPNKHSRFNVYCFRDSGQPSAIPEASDLASD
ALEAIVTVTETLEELQLPREAVESESRGAIYSIPIMEDGTGGSSTPEDPAEAPRTLLEFE
TQSIVPPLGSSEEEGKVLEEEETYKDEEEKEEEEEEEEEVEDEALWAWPSELSSLDPEAP
LPTEPAPEESLSRASPPVRAVLKPDASPPPYGEPEAPRPPTVLGPPTEALPSPREGNLAS
PSPSAPVGAREIGKETGGPELSGVPRGESEETGSSEDAPSLLPATRAPEGTRDLETPSEE
NSGRTVPAGTSVHAQPVLPTDSASHGGVAVAPSSGYCVPSPCHNGGTCLEEEEGVRCLCL
PGYGGDLCDVGLHFCSPGWDAFQGACYKHFSTRRSWEEAENKCRMYGAHLASVSTPEEQD
FINNRYREYQWIGLNDRTIEGDFLWSDGVSLLYENWNPGQPDSYFLSGENCVVMVWHDQG
QWSDVPCNYHLSYTCKMGLVSCGPPPELPLARVFGRPRLRYEVDTVLRYRCLEGLAQRNL
PLIRCQENGRWEPPQISCVPRRPARALRPIKAPEGHQRRLLGSWKARLTPPPNPAPGP
Download sequence
Identical sequences ENSTTRP00000013753 ENSTTRP00000013753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]