SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013799 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013799
Domain Number 1 Region: 203-427
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.04e-45
Family Voltage-gated potassium channels 0.00091
Further Details:      
 
Domain Number 2 Region: 42-160
Classification Level Classification E-value
Superfamily POZ domain 2.88e-28
Family Tetramerization domain of potassium channels 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013799   Gene: ENSTTRG00000014552   Transcript: ENSTTRT00000014552
Sequence length 495
Comment pep:known_by_projection scaffold:turTru1:scaffold_90937:7776:13409:-1 gene:ENSTTRG00000014552 transcript:ENSTTRT00000014552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPPRGRASPDSPLDSASLTSLDSSVFCSEGEGEPLALGDSFTVNVGGSRFVLSQQALSCF
PHTRLGKLAVVVASCRRPGALTAVPSPLELCDDANPVDNEYFFDRSSQAFRYVLHYYRTG
RLHVMEQLCALSFLQEIQYWGIDELSIDSCCRDRYFRRKELSETLDFKKDTEDQESQHES
EQDFSQGPCPTVRQKLWNILEKPGSSTAARIFGVISIIFVAVSIVNMALMSAELSWLDLQ
LLEILYVCISWFTGEFVLRFLCVRDRCRFLRKVPNIIDLLAILPFYITLLVESLSSQTTQ
ELENVGRIVQVLLPRALRMLKLHSTGLRSLGMTITQCYEEVGLLLLFLSVGISIFSTVEY
FAEQSIPDTTFTSVPCAWWWATTSMTTVGYGDIRPDTTTGKIVAFMCILSGILVLALPIA
IINDRFSACYFTLKLKEAAVRQREALKKLTKNIATDSYISVNLRDVYARSIMEMLRLKGR
ERASTRSSGGDDFWF
Download sequence
Identical sequences ENSTTRP00000013799 ENSTTRP00000013799

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]