SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013819 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013819
Domain Number 1 Region: 14-145
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.54e-41
Family Regulator of G-protein signaling, RGS 0.0000569
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013819   Gene: ENSTTRG00000014573   Transcript: ENSTTRT00000014572
Sequence length 164
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3417:286052:311472:-1 gene:ENSTTRG00000014573 transcript:ENSTTRT00000014572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IHDSDGSSSSSHQNPKSADKWAASLENLLEDPEGVKRFREFLKKEFSEENVLFWLACEDF
KKTQDKKQMQEKAKEIYMTFLSSKASSQVNVEGQSRLNETILEEPHPLMFQKLQDQIFNL
MKYDSYSRFLKSDLFLKHKRTEEEDEGPPDAQTAAKRASRIYNT
Download sequence
Identical sequences ENSTTRP00000013819 ENSTTRP00000013819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]