SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013832 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013832
Domain Number 1 Region: 1-205
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 1.91e-52
Family Proteasome subunits 0.0000000643
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013832   Gene: ENSTTRG00000014586   Transcript: ENSTTRT00000014586
Sequence length 221
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2051:3075:20045:1 gene:ENSTTRG00000014586 transcript:ENSTTRT00000014586 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGIRGADIVVLGVEKKSVAKLQDERIVRKICALDDHVCMAFAVSTTFIGLTADARVVINR
ARVECQSHKLTVEDPVTVEYITRFIATLKQKYTQSNGRRPFGISALIVGFDNDGIPRLYQ
TDPSGTYHAWKANAIGRSAKTVREFLEKNYTEDAIANDSEAIKLAIRALLEVVQYGGKNE
LAIIGRKQPLKMFSAKEIELQVNETGKKKEEAKKKKSKKTA
Download sequence
Identical sequences ENSTTRP00000013832 ENSTTRP00000013832

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]