SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013840 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013840
Domain Number 1 Region: 378-729
Classification Level Classification E-value
Superfamily Phosphofructokinase 3.53e-92
Family Phosphofructokinase 0.0000343
Further Details:      
 
Domain Number 2 Region: 68-235
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.7e-45
Family Phosphofructokinase 0.000046
Further Details:      
 
Domain Number 3 Region: 319-404
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.01e-17
Family Phosphofructokinase 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013840   Gene: ENSTTRG00000014594   Transcript: ENSTTRT00000014595
Sequence length 743
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1648:6861:29976:1 gene:ENSTTRG00000014594 transcript:ENSTTRT00000014595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VRCKYGKGRESLRQGHPVRGTRHSRRAPKLPWAPARGSQCGGWARGARTGPLTSAPGGTH
SRAGPRRMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIRPANWLSVSNIIQLGGT
VIGSARCKAFTTREGRRAAAYNLVQRGITNLCVIGGDGSLTGANIFRSEWGSLLEELVSE
GKISQSTAQTYSHLSIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXEAPPEDGWENFMCERLGEXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVM
ALLEATPHTPACVVSLSGNQSVRLPLMECVQMTKEVQKAMDEKRFEEAIQLRGRSFENNW
NIYKLLAHQKISKEKTSFSLAILNVGAPAAGMNAAVRSAVRTGISQGHTVYVVHDGFEGL
AKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGXXXXXXXXXXXXXXXXXXXXXXXXAYE
GVLQLVEARERYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSASGT
KRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIQDLKANVEHMTEKMKTDIQRG
LVLRNEKCHEHYTTEFLYNLYSSEGKGIFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKA
ILWMSEKLRAVYRKGRVFANAPD
Download sequence
Identical sequences ENSTTRP00000013840 ENSTTRP00000013840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]