SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000013949 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000013949
Domain Number 1 Region: 774-963
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.36e-56
Family Nucleotide and nucleoside kinases 0.0000000952
Further Details:      
 
Domain Number 2 Region: 506-603
Classification Level Classification E-value
Superfamily PDZ domain-like 5.65e-32
Family PDZ domain 0.000077
Further Details:      
 
Domain Number 3 Region: 607-721,768-802
Classification Level Classification E-value
Superfamily SH3-domain 4.73e-31
Family SH3-domain 0.0000716
Further Details:      
 
Domain Number 4 Region: 184-287
Classification Level Classification E-value
Superfamily PDZ domain-like 8.94e-30
Family PDZ domain 0.000041
Further Details:      
 
Domain Number 5 Region: 291-382
Classification Level Classification E-value
Superfamily PDZ domain-like 7.76e-27
Family PDZ domain 0.0000306
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000013949
Domain Number - Region: 79-119
Classification Level Classification E-value
Superfamily Pheromone ER-23 0.0536
Family Pheromone ER-23 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000013949   Gene: ENSTTRG00000014710   Transcript: ENSTTRT00000014710
Sequence length 966
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1929:24127:1572773:-1 gene:ENSTTRG00000014710 transcript:ENSTTRT00000014710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FGFTVSTHFYQIQEFYEMTLLNSQKSCEQKIEEANQVAQKWEKTSLLAPCHDNLQKSVEL
TCCSGPKENAACTEQNKDNQCFENETDKKTRQNQGKCPAQNCSVEAPAWMPVHHCTKYRY
QDEDTPHDHSLPRLTHEVRGPELVHVSEKNLSQIENVHGYVLQSHISPLKASPAPIIVNT
DTLDTIPYVNGTEIEYEFEEITLERGNSGLGFSIAGGTDNPHIGDDPGIFITKIIPGGAA
AEDGRLRVNDCILRVNEVDVSEVSHSKAVEALKEAGSIVRLYVRRRRPILETVVEIKLFK
GPKGLGFSIAGGVGNQHIPGDNSIYVTKIIDGGAAQKDGRLQVGDRLLMVNNYSLEEVTH
EEAVAILKNTSDVVYLKVGKATTIYMTDPYGPPDITHSYSPPMGNHLLSGNNGTLEYKTS
LPPISPGRYSPIPKHMLVEDDYTXXXXXXYSTVNKLCDKASRHYPECDKSFFSAPYPHYH
VGLPDSEMTSHSQHSTTTRQPSVSLQRAISLEGEPRKVVLHKGSTGLGFNIVGGEDGEGI
FVSFILAGGPADLSGELQRGDQILSVNGIDLRGASHEQAAAALKGAGQTVTIIAQYQPED
YARFEAKIHDLREQMMNHSMSSGSGSLRTNQKRSLYVRAMFDYDKSKDSGLPSQGLSFKY
GDILHVINASDDEWWQARRVTLEGDSEEMGVIPSKRRVERKERARLKTVKFNAKPGVIDS
KGSFNDKRKKSFIFSRKFPFYKNKEQSEQETSDPERGQEDFILSYEHVTRQEINYTRPVI
ILGPMKDRINDDLISEFPDKFGSCVPHTTRPKRDYEVDGRDYHFVISREQMEKDIQEHKF
IEAGQYNDNLYGTSVQSVRFVAERGKHCILDVSGNAIKRLQVAQLYPIAIFIKPKSLEPL
MEMNKRLTEEQAKKTYDRAIKLEQEFGEYFTAIVQGDTLEDIYNQCKLVIEEQSGPFIWI
PSKEKL
Download sequence
Identical sequences ENSTTRP00000013949 ENSTTRP00000013949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]