SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014000 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014000
Domain Number 1 Region: 157-281
Classification Level Classification E-value
Superfamily PH domain-like 2.07e-25
Family Pleckstrin-homology domain (PH domain) 0.0000272
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014000
Domain Number - Region: 860-918,991-1061,1132-1183,1372-1550
Classification Level Classification E-value
Superfamily ARM repeat 0.000525
Family Mo25 protein 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014000   Gene: ENSTTRG00000014758   Transcript: ENSTTRT00000014764
Sequence length 2078
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1849:35207:228599:1 gene:ENSTTRG00000014758 transcript:ENSTTRT00000014764 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEVRKFTKRLSKPGTAAELRQSVSEAVRGSVVLEKTKVVEPLDYENVITQRKTQIYSDP
LRDLLMFPMEDISISVISRQRRTVQSTVPEDGEKRAQSLFVKECIKTYSTDWHVVNYKYE
DFSGDFRMLPCKSLRPEKIPNHVFEIDEDCEKDEDSSSLCSQKGGVIKQGWLHKANVNST
ITVTMKVFKRRYFYLTQLPDGSYILNSYKDEKNSKESKGCIYLDACIDVVQCPKMRRHAF
ELKMLDKYSHYLAAETEQEMEEWLITLKKIIQINTDSLVQEKKETVEAAQDDETSSQGKA
ENIMASLERSMHPELMKYGRETEQLNKLSRGDGRQNLFSFDSEVQRLDFSGIEPDIKPFE
EKCNKRFLVNCHDLTFNILGQVGDNAKGPPTNVEPFFINLALFDVKNNCKISADFHVDLN
PASVREMLWSPSTQLASDGNSRGSSPESFIHGIAESQLRYIRQGIFSVTNPHPEIFLVAR
IEKVLQGNITHCAEPYVKNSDPAKTAQKVHRTAKQVCSRLGQYRMPFAWAARPIFKDIQG
SLDLDGRFSPLYKQDSSKLSNEDILKLLSEYKKPEKTKLQIIPGQLNITVECVPVDLSNC
ITSSYVPLKPFEKNCQNITVEVEEFVPEMTKYCYPFTVYKNHLYVYPLQLKYDSQKTFAK
ARNIAVCVEFRDSDESDASAVKCIYGKPAGPVFTTNAYAVVSHHNQNPEFYDEIKIELPI
HLHQKHHLLFTFYHVSCEINTKGTTKKQDTVETPVGFAWVPLLKDGRIITFEQQLPVSAN
LPPGYLNLNDAESRRQSNVDIKWVDGAKPLLKIKSHLESTIYTQDLHVHKFFHHCQLIQS
GSKEVPGELIKYLKCLHAMEIQVMIQFLPVILMQLFRVLTNMTHEDDVPINCTMVLLHIV
SKCHEEGLDNYLRSFIKYSFRPEKPSTPQAQLIHETLATTMIAVLKQSADFLAINKLLKY
SWFFFEIIAKSMATYLLEENKIKLPRGQRFSEAYHHVLHSLFLAVIPHVTIHYAEIPDES
RNVNYSLASFLKRCLTLMDRGFVFNLINDYISGFSPKDPKVLAEYKFEFLQTVCNHEHYI
PLNLPMAFAKPKLQRVQDSNLEYSLSDEYCKHHFLVGLLLRETSIALQDNYDIRYTAISV
IKNLLIKHAFDTRYQQKNQQAKIAQLYLPFVGLLLENIQRLAGRDTLYSCAAMPNSASRD
EFACGFASPTSRGSLSTDKDTAYGSFQNGHGIKREDSRGSLIPEGATGFPDQGSTGENTR
HSSARSSVSQYNRLDQYEIRSLLMCYLYIVKMISEDTLLTYWNKVSPQELINILILLEVC
LFHFRYMGKRNIARVHDAWMSKHFGIDRKSQTMPALRNRSGIMQARLQHLSSLESSFTLN
HSSATTEADIFHQALLEGNTATEVSLTVLDTISFFTQCFKSQLLNNDGHNPLMKKVFDIH
LAFLKNGQSEVSLKHVFASLRAFISKFPSAFFKGRVNMCAAFCYEVLKCCTSKISSTRNE
ASALLYLLMRNNFEYTKRKTFLRTHLQIIIAVSQLIADVALSGGSRFQESLSIISNFANS
DRPMKATAFPTEVKDLTKRIRTVLMATAQMKEHEKDPEMLIDLQYSLAKSYASTPELRKT
WLDSMAKIHIKNGDFSEAAMCYVHVAGLVAEFLHRKKLFPSGCSAFKKITPNIDEEGAMK
EDAGMMDVHYSEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKLTQVYR
TLHGAYTKILEVMHTKKRLLGTFFRVAFYGQSFFEEEDGKEYIYKEPKLTGLSEISLRLV
KLYGEKFGTENVKIIQDSDKVNVKELDPKYAHIQVTYVKPYFDDKELTERKTEFERNHNI
NRFVFEAPYTLSGKKQGCIEEQCKRRTILTTSNSFPYVKKRIPINYEQQINLKPIDVATD
EIKDKTAELQKLCSSADVDMIQLQLKLQGCVSVQVNAGPLAYARAFLNDSQASKYPPKKV
NELKDMFRKFIQACSIALELNERLIKEDQIEYHEGLKSNFRDMVKELSDIIHEQASIRIL
QEDTMHSPWMSNTLHVFCAISGTSSDRGYGSPRYAAEI
Download sequence
Identical sequences ENSTTRP00000014000 ENSTTRP00000014000

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]