SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014002 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014002
Domain Number 1 Region: 31-451
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.76e-108
Family L-arabinose binding protein-like 0.00000000000187
Further Details:      
 
Domain Number 2 Region: 855-1046
Classification Level Classification E-value
Superfamily Nucleotide cyclase 4.4e-67
Family Adenylyl and guanylyl cyclase catalytic domain 0.0000425
Further Details:      
 
Domain Number 3 Region: 553-836
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.41e-54
Family Protein kinases, catalytic subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014002   Gene: ENSTTRG00000014761   Transcript: ENSTTRT00000014766
Sequence length 1055
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1699:15117:27920:1 gene:ENSTTRG00000014761 transcript:ENSTTRT00000014766 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRPGCPSGARLRLLLLLPPLLLLPGSYAGNLTVAVVLLANTSYPWSWARVGPAVELTLA
QVKARPDLLPSTVRTVLSSSESALSVCSDTAAPLAAVDLKEHNPAVFLSPGCVYAAAPVG
RFTAHWRVPLLTAGAPAVGFGAKDEYALTTRAGPSHAKLGDFVAALHRRLGWERQALVLY
AYQPRDDQPCFFVVEGLYMQVRDRLNITVDHLEFAEGDRDHYTMLLRTVRRKGRVVYICS
SPDTFRTLMLLALEAGLSGEDYVFFHLDLFGQSLQGAHGLAPHRPWERGDGQDVSAHQAF
QAAKIITYKEPDNPEYLEFLQKLKHLAHEQFNFTMEDGLVNTIPASFHDGLLLYVQAVSE
TLAHGGTVTDGEGITQRMWNRSFQGVTGYLKMDSNGDRETDFSLWDMDPDTGAFRVVLNF
NGTSQELVTVSGRKLNWPLGYPPPDVPKCGFDNEDPACNQDHFSTLEVLALVGSLSLLSI
LLISFFIYRKMQLEKELASELWRVRWEDLQPSSLERHLRSAGSRLTLSGRGSNYGSLLTT
EGQFQIFAKTAYYKGNLVAVKRVNRKRIELTREVLFELKHMRDVQNEHLTRFVGACTDPP
NICILTEYCPRGSLQDILENESITLDWMFRYSLTHDIVKGMLFLHNGAICSHGNLKSSNC
VVDGRFVLKITDYGLESFRDPEPEQGHTLYAKKLWTAPELLRMASPPARGSQAGDVYSFG
IILQEIALRSGVFHVEGLDLSPKEIIERVTRGEQPPFRPSLALQSHLEELGQLMQRCWAE
DPQERPPFQQIRLMLRKFNRENSSNILDNLLSRMEQYANNLEELVEERTQAYLEEKRKAE
ALLYQILPHSVAEQLKRGETVQAEAFDSVTIYFSDIVGFTALSAESTPMQVVTLLNDLYT
CFDAVIDNFDVYKVETIGDAYMVVSGLPVRNGRLHAREVARMALALLDAVRSFRIRHRPQ
EQLRLRIGIHTGPVCAGVVGLKMPRYCLFGDTVNTASRMESNGEALKIHLSSETKAVLEE
FGGFELELRGDVEMKGKGKVRTYWLLGERASSTRG
Download sequence
Identical sequences ENSTTRP00000014002 ENSTTRP00000014002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]