SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014051 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014051
Domain Number 1 Region: 31-238
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 8.14e-52
Family Proteasome subunits 0.00000000426
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014051   Gene: ENSTTRG00000014822   Transcript: ENSTTRT00000014822
Sequence length 239
Comment pep:known_by_projection scaffold:turTru1:scaffold_112311:11592:29506:-1 gene:ENSTTRG00000014822 transcript:ENSTTRT00000014822 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSSAAAYSGPGRDPAMEPHSAPGPLQLRFSPYAFNGGTVLAIAGEDFSIVASDTRLSEG
FSIHTRDSPKCYKLTDKTVIGCSGFHGDCLTLTKIIEARLKMYKHSNNKVMTTGAIAAML
STILYSRRFPYYVYNIIGLDXXXKGAVYSFDPVGSYQRDSFKAGGSASAMLQPLLDNQVG
FKNMQNVEHVPLSLDRAMRLVKDVFISAAERDVYTGDALRICIVTKEGIREETVPLRKD
Download sequence
Identical sequences ENSTTRP00000014051 ENSTTRP00000014051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]