SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014075 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014075
Domain Number 1 Region: 435-636
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.7e-50
Family DBL homology domain (DH-domain) 0.00021
Further Details:      
 
Domain Number 2 Region: 170-249
Classification Level Classification E-value
Superfamily BRCT domain 4.22e-18
Family DNA ligase 0.035
Further Details:      
 
Domain Number 3 Region: 688-793
Classification Level Classification E-value
Superfamily PH domain-like 0.000000685
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 298-354
Classification Level Classification E-value
Superfamily BRCT domain 0.000000916
Family DNA ligase 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014075   Gene: ENSTTRG00000014845   Transcript: ENSTTRT00000014846
Sequence length 914
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1757:160383:220076:1 gene:ENSTTRG00000014845 transcript:ENSTTRT00000014846 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAENSALTSTTGSTSLADSSIFDSKVTETSKENLFIGSTSYVEEEMPQIETRIILVQEAG
KQEELIKALKTIKIMEVPVIKIKESCPGKSDEKFIKSIVNMEIKVPFVKMESVEEFKSLD
SPEFENVFIVMDFQDSVFNELYKTDCRVIGPPVVLNYAQKGEPLPFSCRPLYCTSMMNLV
LCFTGFRKKEELVRLVTLVHHMGGVIRKDFNSKVTHLVANCTQGEKFRIAVSLGTPIMKP
EWIYKAWERRNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGNY
LPVGDERCTHLIVEENIVKELPFEPSKKLYVVKQEWFWGSIQMDARAGETMYLYEKANTP
ELKKSVSLLSLNTPNSNRKRRRLKETLAQLSRETDMSPFPPRKRPSAEHSLSIGSLLDIS
NTPESSINYGETPKSCTKSSKNSTPVPSKQSARWQVARELYQTESNYVNILATIIQLFQV
PLEEEGQRGGPILAPEEIKTIFGSIPDIFDVHTKIKDDLEDLIVNWDESKSIGDIFLKYS
KDLVKTYPPFVNFFEMSKETIIKCEKQKPRFHAFLKINQAKPECGRQSLVELLIRPVQRL
PSVALLLNDLKKHTAEENPDKSTLEKAIGSLKEVMTXXXXXXXXXXXXXXXXXXXXXXXX
XXANLLSSHRSLVQRVETISLGEHPCDRGEQVTLFLFNDCLEIARKRHKVIGTFRSPHGQ
TRPPASLKHIHLMPLSQIKKVLDIRETEDCHNAFALLVRPPTEQANVLLSFQMTSEEPPK
ENWLKMLCRHVANTICKADAENLIYTADPESFEVNTKDMDSTLSRASRAIKKTSKKVTRA
FSFSKTPKRALRRALMTSQSSVEGRSPSSNDKHVMSRLSSTSSLAGIPSPSLVSLPSFFE
RRSHTLSRSTTHLI
Download sequence
Identical sequences ENSTTRP00000014075 ENSTTRP00000014075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]