SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014089 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014089
Domain Number 1 Region: 59-186
Classification Level Classification E-value
Superfamily Lysozyme-like 2.37e-38
Family C-type lysozyme 0.0000236
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014089   Gene: ENSTTRG00000014861   Transcript: ENSTTRT00000014861
Sequence length 188
Comment pep:novel scaffold:turTru1:scaffold_93758:41190:52144:1 gene:ENSTTRG00000014861 transcript:ENSTTRT00000014861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEAPVSCPSLIECRSVSPPESPEGVCEAGTFFCLQQAGMKAAGTLALMGCLITVVEPKI
YTRCKLAKIFSRAGLDNYRGFSLGNWICMAYYESHYNTTAQTDLQDGSTDYGIFKINSYT
WCRRAKLQEKNHCHVACSXXXXXXXHTDAIICAKKIVKETDGMIYWQGWKKHCEGKDLSG
WKKGCEVS
Download sequence
Identical sequences ENSTTRP00000014089 ENSTTRP00000014089

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]