SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014107 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014107
Domain Number 1 Region: 176-235
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000089
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 239-300
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000021
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 3 Region: 52-114
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000513
Family Complement control module/SCR domain 0.0029
Further Details:      
 
Domain Number 4 Region: 113-174
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000354
Family Complement control module/SCR domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014107   Gene: ENSTTRG00000014881   Transcript: ENSTTRT00000014879
Sequence length 487
Comment pep:known_by_projection scaffold:turTru1:scaffold_116108:69831:188840:-1 gene:ENSTTRG00000014881 transcript:ENSTTRT00000014879 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYHGMNPSNGDGFLEQQQPQSPQRLLAVILWFQLALCFGPAQLTGGFDDLQVCADPGVPE
NGFRTPSGGVFFESSVTRFHCQDGFKLKGSTKRLCMKHLNGTLGWIPSDKPVCVQEDCRI
PQIEDAEIHNKTYRHGDKLIITCHEGFKIRYPDLYNMASLCRDDGTWDHLPICQGCLRPL
ASSNGYVNISEFQTSFPVGTVISYHCFPGFKLEGSEYLECLHNLIWSSSPPRCLALEAQV
CPLPPMVSHGDFICHPRPCERYNHGTVVEFYCDPGYSLTSDYKYITCQYGEWFPSYQVYC
IKSEQTWPSTHETLLTTWKIVAFTATSVLLLLLLVILARMFQTKFKAHFPPRGPPRSSSS
DPDFVVVDGVPVMLPYDEAVSGGLSALAPGYLSSVGQGCPLPVDDQSPPAYPGSGDTDTG
PGESGTRDSVSGSSELLQSLYSPPTCQGGTRPASDNPDTAPSTAGEVASTSPGIDIADEI
PLMEEDP
Download sequence
Identical sequences ENSTTRP00000014107 ENSTTRP00000014107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]