SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014160 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014160
Domain Number 1 Region: 2671-2962
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.18e-71
Family Protein kinases, catalytic subunit 0.00000108
Further Details:      
 
Domain Number 2 Region: 1280-1459
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.31e-49
Family DBL homology domain (DH-domain) 0.0000000282
Further Details:      
 
Domain Number 3 Region: 1466-1586
Classification Level Classification E-value
Superfamily PH domain-like 7.24e-34
Family Pleckstrin-homology domain (PH domain) 0.00000213
Further Details:      
 
Domain Number 4 Region: 1920-2113
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.44e-33
Family DBL homology domain (DH-domain) 0.0001
Further Details:      
 
Domain Number 5 Region: 2114-2230
Classification Level Classification E-value
Superfamily PH domain-like 2.12e-27
Family Pleckstrin-homology domain (PH domain) 0.00068
Further Details:      
 
Domain Number 6 Region: 2551-2663
Classification Level Classification E-value
Superfamily Fibronectin type III 2.77e-25
Family Fibronectin type III 0.00077
Further Details:      
 
Domain Number 7 Region: 2470-2574
Classification Level Classification E-value
Superfamily Immunoglobulin 3.07e-24
Family I set domains 0.0064
Further Details:      
 
Domain Number 8 Region: 278-414
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-18
Family Spectrin repeat 0.0051
Further Details:      
 
Domain Number 9 Region: 1098-1235
Classification Level Classification E-value
Superfamily Spectrin repeat 6.28e-18
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 10 Region: 500-641
Classification Level Classification E-value
Superfamily Spectrin repeat 1.85e-17
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 11 Region: 842-1001
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000032
Family Spectrin repeat 0.0033
Further Details:      
 
Domain Number 12 Region: 2320-2383
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000366
Family SH3-domain 0.0000323
Further Details:      
 
Domain Number 13 Region: 1645-1710
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000366
Family SH3-domain 0.0033
Further Details:      
 
Domain Number 14 Region: 35-181
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000000196
Family CRAL/TRIO domain 0.015
Further Details:      
 
Domain Number 15 Region: 191-309
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000183
Family Spectrin repeat 0.0084
Further Details:      
 
Domain Number 16 Region: 646-766
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000824
Family Spectrin repeat 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014160   Gene: ENSTTRG00000014904   Transcript: ENSTTRT00000014936
Sequence length 2985
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_2188:2693:576773:1 gene:ENSTTRG00000014904 transcript:ENSTTRT00000014936 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDRFWDQWYLWYLRLLRLLDRGSFRNDGLKASDVLPILKEKVAFVSGGRDKRGGPILTF
PARSNHDRIRQEDLRKLVTYLASVPSEDVCKRGFTVIIDMRGSKWDLIKPLLKTLQEAFP
AEIHVALIIKPDNFWQKQKTNFGSSKFIFETSMVSVEGLTKLVDPSQLTEEFDGSLDYNH
EEWIELRLSLEEFFNSAVHLLSRLEDLQEMLARKEFPVDVEGSRRLIDEHTQLKKKVLKA
PVEELDREGQRLLQCIRCSDGFSGRNCIPGSADFQSLVPKITSLLDKLHSTRQHLHQMWH
VRKLKLDQCFQLRLFEQDAEKMFDWISHNKELFLQSHTEIGVSYQHALDLQTQHNHFAMN
SMNAYVNINRIMSVASRLSEAGHYASQQIKQISTQLDQEWKSFAAALDERSTILAMSAVF
HQKAEQFLSGVDAWCKMCSEGGLPSEMQDLELAIHHHQSLYEQVTQAYTEVSQDGKALLD
VLQRPLSPGNSESLTATANYSKAVHQVLDVVHEVLHHQRRLESIWQHRKVRLHQRLQLCV
FQQDVQQVLDWIENHGEAFLSKHTGVGKSLHRARALQKRHDDFEEVAQNTYTNADKLLEA
AEQLAQTGECDPEEIYKAARHLEVRIQDFVRRVEQRKLLLDMSVSFHTHTKELWTWMEDL
QKEMLEDVCADSVDAVQELIKQFQQQQTATLDATLNVIKEGEDLIQQLRSAPPSLGEPSE
ARDSAVSSNKTPHSSSISHIESVLQQLDDAQVQMEELFHERKIKLDIFLQLRIFEQYTIE
VTAELDAWNEDLLRQMNDFNTEDLTLAEQRLQRHTERKLAMNNMTFEVIQQGQDLHQYIM
EVQASGIELICEKDIDLAAQVQELLEFLQEKQHELELNAEQTHERLEQCLQLRHLQAEVR
QVLGWIRNGESMLNASLVNASSLSEAEQLQREHEQFQLAIESLFHATSLQKTHQSALQVQ
QKAEALLQAGHYDADAIRECAEKVALHWQQLMLKMEDRLKLVNASVAFYKTSEQVCSVLE
SLEQEYRRDEDWCGGRDKLGPAAEIDHVIPLISKHLEQKEAFLKACTLARRNAEVFLKYI
HRNNVSMPSAASHTRGPEQQVKAILSELLQRENRVLHFWTLKKRRLDQCQQYVVFERSAK
QALDWIQETGEYYLSTHTSPGETAEETQELLKEYGEFRVPAKQTKEKVKLLIQLADSFVE
KGHIHATEIRKWVTTVDKHYRDFSLRMGKYRYSLEKALGVNTEDNKDLELDIIPASLSDR
EVKLRDANHEVNEEKRKSARKKEFIMAELLQTEKAYVRDLHECLETYLWEMTSGVEEIPP
GILNKEHIIFGNIQEIYDFHNNIFLKELEKYEQLPEDVGHCFVTWADKFQMYVTYCKNKP
DSXXXXXXXXXXXXXEIQQRHGLANSISSYLIKPVQRITKYQLLLKELLTCCEEGKGELK
DGLEVMLSVPKKANDAMHVSMLEGFDENLDVQGELILQDAFQVWDPKSLIRKGRERHLFL
FEISLVFSKEIKDSSGHTKYVYKNKLLTSELGVTEHVEGDPCKFALWSGRTPSSDNKTVL
KASNIETKQEWIKNIREVIQERIIHLKGALKEPIQLPKTPAKQRNNSKRDGVEDVDSQGD
GSSQPDTISIASRTSQNTVDSDKLSGGCELTVVLQDFNAGHSSELSIQVGQTVELLERPS
ERPGWCLVRTTERSPPQEGLVPSSALCISHSRSSVEMDCFFPLVKDAYSHSSENGGKSES
VANLQAQPSLNSIHSSPGPKRSTNTLKKWLTSPVRRLNSGKADGNIKKQKKVRDGRKSFD
LGSPKPGDETTPQGDSADEKSKKGWGEDEPDEESHTPLPPPMKIFDNDPTQDEMXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXSLEGGSYRGSLKDPTGCLNEGMTPPTPPRNLEEE
QKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDKIVFGNIHQ
IYDWHKDVFLGELEKCIQEQDRLAQLFIKYERKLHIYVWYCQNKPRSEYIVAEYDAYFEE
VXXXXXXXXXXXXXXXXXXXXXXXYQLLLKDFLRYSEKAGLECSDIEKAVELMCLVPKRC
NDMMNLGRLQGFEGTLTAQGKLLQQDTFYVIELDAGMQSRTKERRVFLFEQIVIFSELLR
KGSLTPGYMFKRSIKMNYLVLEENVDSDPCKFALMNRETSERVILQAANADIQHAWVDIN
QVLETQRDFLNALQSPIEYQRKERNTAVMRSQPARVPQASPRPYSSIPVGSEKPPKGSSC
NPPLPPLKISTSNGSSGFDYHQAGDKFEASKQSDLGGCNGVSSMAVIKDYYALKENEICV
SQGEVVQVLAINQQNMCLVYQPASDHSPAAEGWVPGNILAPLTKATAAAENSDGSIKKSC
SWHTLRMRKRAEVENTGKSEATGPRKPKDILGNKVSVKETNSSEESECDDLDPNTSMEIL
NPNFIQEVAPEFLVPLVDVTCLLGDTVTLQCKVCGRPKPTITWKGPDQNILDTDNSSATY
TVSSCDSGEITLKICNLMPQDSGIYTCVAANDHGTTSTSATVKVQGVPAAPNRPIAQERS
CTSVILRWLPPSSTGNCTISGYTVEYREEGSQAWQQSVASTLDTYLVIEDLSPGSPYQFR
VSASNPWGISLPSEPSEFVRLPEYDAAADGTTISWKENFDSAYTELNEIGRGRFSIVKKC
IHKATRKDVAVKFVSKKMKKKEQAAHEAALLQHLQHPQYITLHDTYESPTSYILILELMD
DGRLLDYLMNHDELMEEKVAFYIRDIMEALQYLHNCRVAHLDIKPENLLIDLRIPVPRVK
LIDLEDAVQISGHFHIHHLLGNPEFAAPEVIQGIPVSLGTDIWSIGVLTYVMLSGVSPFL
DESKEETCINVCRVDFSFPHEYFCGVSNAARDFINVILQEDFRRRPTAATCLQHPWLQPH
NGSYSKIPLDTSRLACFIERRKHQNDVRPIPNVKSYIVNRVNQGT
Download sequence
Identical sequences ENSTTRP00000014160 ENSTTRP00000014160

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]