SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014162 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTTRP00000014162
Domain Number - Region: 159-236
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000796
Family CO-sensing protein CooA, N-terminal domain 0.081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014162   Gene: ENSTTRG00000014938   Transcript: ENSTTRT00000014938
Sequence length 290
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_3439:229676:232536:-1 gene:ENSTTRG00000014938 transcript:ENSTTRT00000014938 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERNSSLWKNLIDEHPVCTIWKQEAEGAIYHLASILYVVGFMGGSGFIGLLYVFSLLGLG
FLCSAIWAWVHVCAADIFSWNFILFVICFMRFVHIAYQVRSITFAREFSVLYSSLIQPLG
TSLPDRTIAMSSEVVTFGXXXXXXXXXXXXXXXXXXXXSGRIRVTVDGEFLHYIFPFQFL
DSPEWDSLKPTEEGIFQVTLTAETDCRYVSWRRKKLYLLLAQHRYISRLFSVLIGSDIAD
KLYALNDRVYIGKRYHYDIRLPNFYQMSSPEMSRSTLTEHLQNSRRHCDK
Download sequence
Identical sequences ENSTTRP00000014162 ENSTTRP00000014162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]