SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014231 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014231
Domain Number 1 Region: 162-255
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-28
Family Pleckstrin-homology domain (PH domain) 0.00000761
Further Details:      
 
Domain Number 2 Region: 28-132
Classification Level Classification E-value
Superfamily SH2 domain 1.35e-26
Family SH2 domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014231   Gene: ENSTTRG00000015011   Transcript: ENSTTRT00000015012
Sequence length 280
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_1769:295841:359963:1 gene:ENSTTRG00000015011 transcript:ENSTTRT00000015012 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRAESPEGKMSIQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLL
RNSNERTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETG
TLIVLKHPYPRKVEEPSIYESVRVHTAMQTGRTENDLVPTAPSLGTKEGYLTKQGGLVKT
WKTRWFTLHRNELKYFKDQMXXXPIRSLDLTECSAVQFDYSQERVNCFCLVFPFRTFYLC
AKTGVEADEWIKILRWKLSQIRKQLDQGEGTIRSRSFIFK
Download sequence
Identical sequences ENSTTRP00000014231 ENSTTRP00000014231

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]