SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014249 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014249
Domain Number 1 Region: 389-622
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 9.56e-37
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 
Domain Number 2 Region: 86-242,386-469
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 5.26e-23
Family FAD/NAD-linked reductases, N-terminal and central domains 0.068
Further Details:      
 
Domain Number 3 Region: 989-1022
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000371
Family LIM domain 0.01
Further Details:      
 
Domain Number 4 Region: 1023-1052
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000309
Family LIM domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014249   Gene: ENSTTRG00000015028   Transcript: ENSTTRT00000015031
Sequence length 1119
Comment pep:known_by_projection scaffold:turTru1:scaffold_113729:115041:209291:1 gene:ENSTTRG00000015028 transcript:ENSTTRT00000015031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGENEDEKQAQAGQVFENFVQASTCKGTLQAFNILTRHLDLDPLDHRNFYSKLKSKVTTW
KAKALWYKLDKRGSHKEYKRGKSCMNTKCLIIGGGPCGLRTAIELAYLGAKVVVVEKRDT
FSRNNVLHLWPFTIHDLRGLGAKKFYGKFCAGSIDHISIRQLQLILFKVALILGVEIHVN
VEFVKVLEPPEDQENQKIGWRAEFLPADHSLSEFEFDVIIGADGRRNTLEXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLKEETGIDLENIVYYKDCTHYFV
MTAKKQSLLDKGVIINDYIDTEMLLCAENVNQDNLLSYAREAADFATNYQLPSLDFAMNH
YGQPDVAMFDFTSMYASENAALVRERQSHQLLVALVGDSLLEPFWPMGTGCARGFLAAFD
TAWMVKSWDQGTPPLELLAERESLYRLLPQTTPENINKNFEQYTLDPGTRYPNLNSNCVR
PHQVKQLYITKELHQCPLERLGSVRRSVGLSRRESDIRPSKLLTWCQQQTKGYQHVNVTD
LTTSWRSGLALCAVIHRFRPELINFDSLNEDDTVENNQLAFDVAEREFGIPPVTTGKEMA
SAPQPDKLSMVMYLSKFYELFRGTPLRPVDAWRKNYGENADLGMAKSSISHNYLNLTFPR
KRTPRVDSRTEENDMSKRRRKGFNNLDEPSAFPSQSLGSNQEGCKERGNQKVKSMASQLL
AKFEENSRNSLLRQEHRVSGIGKPILRSSSDPPVNSRRPKPEEPTPSPSPTLKRQFPLVV
VTGHVLRELKQVSAGGECPSRPWRARAKSDLQLGGPENPAGLPATCQGALALSGVLRRLQ
EVEEKVLQKRAQNLANREFHKKNIKEKAAHLASMFGHGDFPQNLLSKSLSHTHPPSSPSC
LPSPDSAATSSPSRVDSVSPARKAKKSPSGFHXXXXXXXXXXXXLTVGKVSSGIGAAAEV
LVNLYMNDHRPKTQAISPDLESIRKAFPLNLGGSDTCYFCKKRVYVMERLSAEGHFFHRE
CFRCSVCATTLRLAAYAFDSDEGKFFCKPHFIHCKTNSQQRKRRAELKQQREEEGMWKEQ
EASRRDPPAESSCAAAAIGTPEGSPPVHFSLPVLHPLLG
Download sequence
Identical sequences ENSTTRP00000014249 ENSTTRP00000014249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]