SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014340 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014340
Domain Number 1 Region: 24-356
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.57e-91
Family Phosphofructokinase 0.000000978
Further Details:      
 
Domain Number 2 Region: 561-768
Classification Level Classification E-value
Superfamily Phosphofructokinase 8.63e-39
Family Phosphofructokinase 0.001
Further Details:      
 
Domain Number 3 Region: 348-509
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.7e-24
Family Phosphofructokinase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014340   Gene: ENSTTRG00000015116   Transcript: ENSTTRT00000015125
Sequence length 778
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_212:219192:282366:1 gene:ENSTTRG00000015116 transcript:ENSTTRT00000015125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDHDVSPNPKGSFRKFLEQLSGAGKAIGVLTSGGDAQXXXXXXXXXXXXXXXXXXXXXX
XXXGYQGMVDGGSNIVEADWESVSSILQVGGTIIGSARCKDFRSREGRLKAAHNLLQLGI
TNLCVIGGDGSLTGANIFRKEWSGLLEELAREGKINTEEVQKHGYLNVVGMVGSIDNDFC
GTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFL
PESPPEEGWQENMCIKLSENRARKKRLNIIIVAEGAIDTQNKAITSEQIKELVVTQLGYD
TRVTILGHVQRGGTPSAFDRILASRMGVEAVVALATPETPACVVSLSGNQAVRLPLMECV
QMTQEVQKAMDERRFKDAVQLRGRSFENNLNTYKRLAIKLPDSQIRKSNCNVGIVNVGAP
AAGMNAAVRAAVRVGISDGHKVFAVYDGFEGFAKGQXXXXXXXXXXXXXXXXXXXXXXXX
TLPGKYLEDIAAQMHTHGINALLIIGGFEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGAD
AYIFEEPFDIRDLQSNVEHTEKMKTTIQRGLVLRNESCSENYTTDFIYQLYSEEGKGVFD
CRKNVLGHMQQGGAPSPFDRNFGTKISARAMQWISAKLKEPAGRGRRFVSDDSVCVLGIS
KRNLLFQPVAELKEETDFVHRIPKEQWWLKLRPLMKILAKYKASFEVSDAGPLEPMQP
Download sequence
Identical sequences ENSTTRP00000014340 ENSTTRP00000014340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]