SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014402 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014402
Domain Number 1 Region: 73-414
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.56e-87
Family Protein kinases, catalytic subunit 0.00000221
Further Details:      
 
Domain Number 2 Region: 947-1012
Classification Level Classification E-value
Superfamily G protein-binding domain 2.46e-19
Family RhoA-binding domain 0.000044
Further Details:      
 
Domain Number 3 Region: 1116-1206,1288-1319
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000631
Family Pleckstrin-homology domain (PH domain) 0.011
Further Details:      
 
Domain Number 4 Region: 1225-1274
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000112
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Domain Number 5 Region: 426-528
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0000288
Family Myosin rod fragments 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSTTRP00000014402
Domain Number - Region: 536-644
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0942
Family Myosin rod fragments 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014402   Gene: ENSTTRG00000015192   Transcript: ENSTTRT00000015191
Sequence length 1353
Comment pep:known_by_projection scaffold:turTru1:scaffold_110258:25107:170776:1 gene:ENSTTRG00000015192 transcript:ENSTTRT00000015191 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLSSANPNENRTSSNV
DKSLQENLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNIKLDKIMKELDEEGNQRRNLEST
VSQIEKEKMLLQHRINEYQRKAEQENEKRRNVENEVSTLKDQLEDLKKVSQNSHLANEKL
AQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSITQLESLNRELQERNRILENSKSQMD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLRVEGERKEAQDMLNH
SEKEKNNLEIDLNYKLKSLQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKLK
EEREAREKAENRVVQIEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLSLQLEQESN
KRLLLQNELKTHAFEADNLKGLEKQMKQEINTXXXXXXXXXXXXXXXXXQYRGNEGQMRE
LQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENSKKIQELQSVXXETLATQLDLAETKAE
SEQLARGLLEEQYFELTQESKKAASRNRQEITDKEHTVSRLEETNSMLTKDIELLRKENE
ELTDKMRKAEEEYKLKKEEEINNLKAAFKNINTERTLKTQAVNKLAEIMNRKDFKIDRKK
ANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQLA
SKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSIPNRGNIKRYGWKKQ
YVVVSSKKILFYNDEQDKEQSNPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILYA
NEGECRKDVEMEPVQQAEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALEC
RRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNPP
SGFVRASPRTLSTRSTANQSFRKVVKNTSGKTR
Download sequence
Identical sequences ENSTTRP00000014402 ENSTTRP00000014402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]