SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTTRP00000014670 from Tursiops truncatus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTTRP00000014670
Domain Number 1 Region: 411-818
Classification Level Classification E-value
Superfamily Phosphofructokinase 2.22e-109
Family Phosphofructokinase 0.0000074
Further Details:      
 
Domain Number 2 Region: 70-409
Classification Level Classification E-value
Superfamily Phosphofructokinase 1.27e-92
Family Phosphofructokinase 0.000000565
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTTRP00000014670   Gene: ENSTTRG00000015473   Transcript: ENSTTRT00000015483
Sequence length 851
Comment pep:known_by_projection genescaffold:turTru1:GeneScaffold_328:82915:124512:1 gene:ENSTTRG00000015473 transcript:ENSTTRT00000015483 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHKEELHLKFFKCVIQSRQLVRTPQRTAEEASTCSMLIQKPPSKTDALKSLDTMDDPDSV
EGIPIFKNEWIMTHEEHHAAKTLGAGKAIAVLTSGGDAQGMNAAVRAVVRVGIYTGARVF
FVHEXXXXXXXXXXXXXXXXXXXXXXXXXXGGTVIGSARCKDFREREGRLRAAHNLVKRG
ITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKSGKITAEEAAKSRYLNIVGLVGSIDNDF
CGTDMTIGTDSALHRIIEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVF
IPECPPDDDWEEHLCRRLSETRNRGSRLNIIIVAEGAIDRNGKPISSEDIKNLVVKRLGY
DTRVTVLGHVQRGGTPSAFDRILGSRMGVEAVMALLEGTPDTPACVVSLSGNQAVRLPLM
ECVQVTKDVTKAMEEKRFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSYTVAVMNVG
APAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGT
KRTLPKKSFEQISANITKFNIQGLVIIGGFEAYTGGLELMEGRKQYDELCIPFVVIPATV
SNNVPGSDFSVGTDTALNTICMTCDRIKQSAAGTKRRVFIIETMGGYCGYLATMAGLAAG
ADAAYIFEEPFTIRDLQVNVEHLVQKMKTTVKRGLVLRNEKCNENYTTDFIFNLYSEEGK
GIFDSRKNVLGHMQQGGSPTPFDRNFATKMGAKAMNWMSGKIKESYRNGRIFANTPDSGC
VLGMRKRALVFQPVAELKEQTDFEHRIPKEQWWLKLRPILKILAKYEIDLDTSEHAHFEH
VSRKRSGEAAI
Download sequence
Identical sequences ENSTTRP00000014670 ENSTTRP00000014670

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]